Recombinant Full Length Human SYAP1 Protein, C-Flag-tagged
Cat.No. : | SYAP1-1701HFL |
Product Overview : | Recombinant Full Length Human SYAP1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Involved in several processes, including TORC2 signaling; cellular response to growth factor stimulus; and cellular response to peptide hormone stimulus. Located in Golgi apparatus; cytosol; and nucleoplasm. Is extrinsic component of cytoplasmic side of plasma membrane. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 39.8 kDa |
AA Sequence : | MFRGLSSWLGLQQPVAGGGQPNGDALPEQPSETVAESAEEELQQAGDQELLHQAKDFGNYLFNFASAATK KITESVAETAQTIKKSVEEGKIDGIIDKTIIGDFQKEQKKFVEEQHTKKSEAAVPPWVDTNDEETIQQQI LALSADKRNFLRDPPAGVQFNFDFDQMYPVALVMLQEDELLSKMRFALVPKLVKEEVFWRNYFYRVSLIK QSAQLTALAAQQQAAGKEEKSNGREQDLPLAEAVRPKTPPVVIKSQLKTQEDEEEISTSPGVSEFVSDAF DACNLNQEDLRKEMEQLVLDKKQEETAVLEEDSADWEKELQQELQEYEVVTESEKRDENWDKEIEKMLQE ENTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | SYAP1 synapse associated protein 1 [ Homo sapiens (human) ] |
Official Symbol | SYAP1 |
Synonyms | BSTA; PRO3113 |
Gene ID | 94056 |
mRNA Refseq | NM_032796.4 |
Protein Refseq | NP_116185.2 |
UniProt ID | Q96A49 |
◆ Recombinant Proteins | ||
SYAP1-3065H | Recombinant Human SYAP1, GST-tagged | +Inquiry |
SYAP1-5105C | Recombinant Chicken SYAP1 | +Inquiry |
SYAP1-1701HFL | Recombinant Full Length Human SYAP1 Protein, C-Flag-tagged | +Inquiry |
Syap1-6237M | Recombinant Mouse Syap1 Protein, Myc/DDK-tagged | +Inquiry |
SYAP1-01H | Recombinant Human SYAP1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SYAP1-1324HCL | Recombinant Human SYAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SYAP1 Products
Required fields are marked with *
My Review for All SYAP1 Products
Required fields are marked with *
0
Inquiry Basket