Recombinant Full Length Human Syntaxin-2(Stx2) Protein, His-Tagged
Cat.No. : | RFL15805HF |
Product Overview : | Recombinant Full Length Human Syntaxin-2(STX2) Protein (P32856) (1-288aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-288) |
Form : | Lyophilized powder |
AA Sequence : | MRDRLPDLTACRKNDDGDTVVVVEKDHFMDDFFHQVEEIRNSIDKITQYVEEVKKNHSIILSAPNPEGKIKEELEDLNKEIKKTANKIRAKLKAIEQSFDQDESGNRTSVDLRIRRTQHSVLSRKFVEAMAEYNEAQTLFRERSKGRIQRQLEITGRTTTDDELEEMLESGKPSIFTSDIISDSQITRQALNEIESRHKDIMKLETSIRELHEMFMDMAMFVETQGEMINNIERNVMNATDYVEHAKEETKKAIKYQSKARRKKWIIIAVSVVLVAIIALIIGLSVGK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | STX2 |
Synonyms | STX2; EPIM; STX2A; STX2B; STX2C; Syntaxin-2; Epimorphin |
UniProt ID | P32856 |
◆ Recombinant Proteins | ||
RFL15805HF | Recombinant Full Length Human Syntaxin-2(Stx2) Protein, His-Tagged | +Inquiry |
STX2-3547C | Recombinant Chicken STX2 | +Inquiry |
Stx2-961M | Recombinant Mouse Stx2 Protein, MYC/DDK-tagged | +Inquiry |
STX2-1546H | Recombinant Human STX2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
STX2-4748HF | Recombinant Full Length Human STX2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
STX2-1718HCL | Recombinant Human STX2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STX2 Products
Required fields are marked with *
My Review for All STX2 Products
Required fields are marked with *
0
Inquiry Basket