Recombinant Full Length Human STX2 Protein, GST-tagged
| Cat.No. : | STX2-4748HF | 
| Product Overview : | Human EPIM full-length ORF ( NP_001971.2, 1 a.a. - 287 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 287 amino acids | 
| Description : | The product of this gene belongs to the syntaxin/epimorphin family of proteins. The syntaxins are a large protein family implicated in the targeting and fusion of intracellular transport vesicles. The product of this gene regulates epithelial-mesenchymal interactions and epithelial cell morphogenesis and activation. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008] | 
| Molecular Mass : | 59.7 kDa | 
| AA Sequence : | MRDRLPDLTACRKNDDGDTVVVVEKDHFMDDFFHQVEEIRNSIDKITQYVEEVKKNHSIILSAPNPEGKIKEELEDLNKEIKKTANKIRAKLKAIEQSFDQDESGNRTSVDLRIRRTQHSVLSRKFVEAMAEYNEAQTLFRERSKGRIQRQLEITGRTTTDDELEEMLESGKPSIFTSDIISDSQITRQALNEIESRHKDIMKLETSIRELHEMFMDMAMFVETQGEMINNIERNVMNATDYVEHAKEETKKAIKYQSKARRKLMFIIICVIVLLVILGIILATTLS | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array  | 
                                
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | STX2 syntaxin 2 [ Homo sapiens ] | 
| Official Symbol | STX2 | 
| Synonyms | STX2; syntaxin 2; EPIM, epimorphin , STX2A, STX2B, STX2C; syntaxin-2; EPM; epimorphin; EPIM; STX2A; STX2B; STX2C; MGC51014; | 
| Gene ID | 2054 | 
| mRNA Refseq | NM_194356 | 
| Protein Refseq | NP_919337 | 
| MIM | 132350 | 
| UniProt ID | P32856 | 
| ◆ Recombinant Proteins | ||
| STX2-512HF | Recombinant Full Length Human STX2 Protein | +Inquiry | 
| STX2-2990H | Recombinant Human STX2 Protein, MYC/DDK-tagged | +Inquiry | 
| RFL20799RF | Recombinant Full Length Rat Syntaxin-2(Stx2) Protein, His-Tagged | +Inquiry | 
| RFL15805HF | Recombinant Full Length Human Syntaxin-2(Stx2) Protein, His-Tagged | +Inquiry | 
| STX2-4046H | Recombinant Human STX2 Protein, GST-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| STX2-1718HCL | Recombinant Human STX2 cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All STX2 Products
Required fields are marked with *
My Review for All STX2 Products
Required fields are marked with *
  
        
    
      
            