Recombinant Full Length Human SYP Protein
| Cat.No. : | SYP-513HF |
| Product Overview : | Recombinant full length Human Synaptophysin with N terminal proprietary tag; predicted MWt 60.54 kDa inclusive of tag. AAH64550.1 |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 313 amino acids |
| Description : | This gene encodes an integral membrane protein of small synaptic vesicles in brain and endocrine cells. The protein also binds cholesterol and is thought to direct targeting of vesicle-associated membrane protein 2 (synaptobrevin) to intracellular compartments. Mutations in this gene are associated with X-linked mental retardation (XLMR). |
| Form : | Liquid |
| Molecular Mass : | 60.540kDa inclusive of tags |
| AA Sequence : | MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAI FAFATCGSYSGELQLNVDCANKTESDLSIEVEFEYPFRLH QVYFDAPTCRGGTTKVFLVGDYSSSAEFFVTVAVFAFLYS MGALATYIFLQNKYRENNKGPMLDFLATAVFAFMWLVSSS AWAKGLSDVKMATDPENIIKEMPVCRQTGNTCKELRDLVT SGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFLRAPPG APEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDY GQPAGSGGSGYGPQGDYGQQGYGPQGAPTSFSNQM |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | SYP synaptophysin [ Homo sapiens ] |
| Official Symbol | SYP |
| Synonyms | SYP; synaptophysin |
| Gene ID | 6855 |
| mRNA Refseq | NM_003179 |
| Protein Refseq | NP_003170 |
| MIM | 313475 |
| UniProt ID | P08247 |
| ◆ Recombinant Proteins | ||
| SYP-2596H | Recombinant Human SYP protein(228-313 aa), N-SUMO & N-His-tagged | +Inquiry |
| Syp-0148R | Recombinant Rat Syp Full Length Transmembrane protein, His-tagged | +Inquiry |
| SYP-3076H | Recombinant Human SYP, His-tagged | +Inquiry |
| RFL20132BF | Recombinant Full Length Bovine Synaptophysin(Syp) Protein, His-Tagged | +Inquiry |
| SYP-4587R | Recombinant Rhesus monkey SYP Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SYP-1313HCL | Recombinant Human SYP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SYP Products
Required fields are marked with *
My Review for All SYP Products
Required fields are marked with *
