Recombinant Full Length Human SYP Protein
Cat.No. : | SYP-513HF |
Product Overview : | Recombinant full length Human Synaptophysin with N terminal proprietary tag; predicted MWt 60.54 kDa inclusive of tag. AAH64550.1 |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 313 amino acids |
Description : | This gene encodes an integral membrane protein of small synaptic vesicles in brain and endocrine cells. The protein also binds cholesterol and is thought to direct targeting of vesicle-associated membrane protein 2 (synaptobrevin) to intracellular compartments. Mutations in this gene are associated with X-linked mental retardation (XLMR). |
Form : | Liquid |
Molecular Mass : | 60.540kDa inclusive of tags |
AA Sequence : | MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAI FAFATCGSYSGELQLNVDCANKTESDLSIEVEFEYPFRLH QVYFDAPTCRGGTTKVFLVGDYSSSAEFFVTVAVFAFLYS MGALATYIFLQNKYRENNKGPMLDFLATAVFAFMWLVSSS AWAKGLSDVKMATDPENIIKEMPVCRQTGNTCKELRDLVT SGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFLRAPPG APEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDY GQPAGSGGSGYGPQGDYGQQGYGPQGAPTSFSNQM |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | SYP synaptophysin [ Homo sapiens ] |
Official Symbol | SYP |
Synonyms | SYP; synaptophysin |
Gene ID | 6855 |
mRNA Refseq | NM_003179 |
Protein Refseq | NP_003170 |
MIM | 313475 |
UniProt ID | P08247 |
◆ Recombinant Proteins | ||
SYP-4403R | Recombinant Rhesus Macaque SYP Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL20132BF | Recombinant Full Length Bovine Synaptophysin(Syp) Protein, His-Tagged | +Inquiry |
SYP-2596H | Recombinant Human SYP protein(228-313 aa), N-SUMO & N-His-tagged | +Inquiry |
SYP-3076H | Recombinant Human SYP, His-tagged | +Inquiry |
SYP-5874R | Recombinant Rat SYP Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SYP-1313HCL | Recombinant Human SYP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SYP Products
Required fields are marked with *
My Review for All SYP Products
Required fields are marked with *
0
Inquiry Basket