Recombinant Full Length Human TACSTD2 Protein
| Cat.No. : | TACSTD2-515HF |
| Product Overview : | Recombinant full length Human TACD2 with N terminal proprietary tag, 58.78kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 298 amino acids |
| Description : | This intronless gene encodes a carcinoma-associated antigen. This antigen is a cell surface receptor that transduces calcium signals. Mutations of this gene have been associated with gelatinous drop-like corneal dystrophy. |
| Form : | Liquid |
| Molecular Mass : | 58.780kDa inclusive of tags |
| AA Sequence : | HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDC STLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDP DCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCD ELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRL HPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYF ERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPP KFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNRRKSGKY KKVEIKELGELRKEPSL |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | TACSTD2 tumor-associated calcium signal transducer 2 [ Homo sapiens ] |
| Official Symbol | TACSTD2 |
| Synonyms | TACSTD2; tumor-associated calcium signal transducer 2; M1S1; EGP 1; GA733 1; TROP2 |
| Gene ID | 4070 |
| mRNA Refseq | NM_002353 |
| Protein Refseq | NP_002344 |
| MIM | 137290 |
| UniProt ID | P09758 |
| ◆ Recombinant Proteins | ||
| TACSTD2-0766R | Recombinant Rabbit TACSTD2 protein, His-tagged | +Inquiry |
| TACSTD2-1848H | Active Recombinant Human TACSTD2 protein, His & Avi-tagged, Biotinylated | +Inquiry |
| TACSTD2-110H | Recombinant Human TACSTD2 protein, His-Avi-tagged, Biotinylated | +Inquiry |
| TACSTD2-78H | Active Recombinant Human TACSTD2 Protein, Flag&His tagged | +Inquiry |
| TACSTD2-0232H | Recombinant Human TACSTD2 protein, His-tagged, Biotinylated | +Inquiry |
| ◆ Native Proteins | ||
| Tacstd2-64M | Active Recombinant Mouse Tacstd2 Homodimer Protein, Flag&His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TACSTD2-1630MCL | Recombinant Mouse TACSTD2 cell lysate | +Inquiry |
| TACSTD2-2546HCL | Recombinant Human TACSTD2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TACSTD2 Products
Required fields are marked with *
My Review for All TACSTD2 Products
Required fields are marked with *
