Recombinant Full Length Human TAPBPL Protein, C-Flag-tagged
Cat.No. : | TAPBPL-842HFL |
Product Overview : | Recombinant Full Length Human TAPBPL Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Tapasin, or TAPBP (MIM 601962), is a member of the variable-constant Ig superfamily that links major histocompatibility complex (MHC) class I molecules to the transporter associated with antigen processing (TAP; see MIM 170260) in the endoplasmic reticulum (ER). The TAPBP gene is located near the MHC complex on chromosome 6p21.3. TAPBPL is a member of the Ig superfamily that is localized on chromosome 12p13.3, a region somewhat paralogous to the MHC. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 50 kDa |
AA Sequence : | MGTQEGWCLLLCLALSGAAETKPHPAEGQWRAVDVVLDCFLVKDGAHRGALASSEDRARASLVLKQVPVL DDGSLEDFTDFQGGTLAQDDPPIIFEASVDLVQIPQAEALLHADCSGKEVTCEISRYFLQMTETTVKTAA WFMANVQVSGGGPSISLVMKTPRVAKNEVLWHPTLNLPLSPQGTVRTAVEFQVMTQTQSLSFLLGSSASL DCGFSMAPGLDLISVEWRLQHKGRGQLVYSWTAGQGQAVRKGATLEPAQLGMARDASLTLPGLTIQDEGT YICQITTSLYRAQQIIQLNIQASPKVRLSLANEALLPTLICDIAGYYPLDVVVTWTREELGGSPAQVSGA SFSSLRQSVAGTYSISSSLTAEPGSAGATYTCQVTHISLEEPLGASTQVVPPERRTALGVIFASSLFLLA LMFLGLQRRQAPTGLGLLQAERWETTSCADTQSSHLHEDRTARVSQPSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Full Length : | Full L. |
Gene Name | TAPBPL TAP binding protein like [ Homo sapiens (human) ] |
Official Symbol | TAPBPL |
Synonyms | TAPBPR; TAPBP-R |
Gene ID | 55080 |
mRNA Refseq | NM_018009.5 |
Protein Refseq | NP_060479.3 |
MIM | 607081 |
UniProt ID | Q9BX59 |
◆ Recombinant Proteins | ||
TAPBPL-16423M | Recombinant Mouse TAPBPL Protein | +Inquiry |
TAPBPL-3023C | Recombinant Chicken TAPBPL | +Inquiry |
TAPBPL-4433R | Recombinant Rhesus Macaque TAPBPL Protein, His (Fc)-Avi-tagged | +Inquiry |
TAPBPL-8987M | Recombinant Mouse TAPBPL Protein, His (Fc)-Avi-tagged | +Inquiry |
TAPBPL-1354H | Recombinant Human TAPBPL Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
TAPBPL-1253HCL | Recombinant Human TAPBPL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TAPBPL Products
Required fields are marked with *
My Review for All TAPBPL Products
Required fields are marked with *
0
Inquiry Basket