Recombinant Full Length Human TBXT Protein, C-Flag-tagged
| Cat.No. : | TBXT-261HFL |
| Product Overview : | Recombinant Full Length Human TBXT Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | The protein encoded by this gene is an embryonic nuclear transcription factor that binds to a specific DNA element, the palindromic T-site. It binds through a region in its N-terminus, called the T-box, and effects transcription of genes required for mesoderm formation and differentiation. The protein is localized to notochord-derived cells. Variation in this gene was associated with susceptibility to neural tube defects and chordoma. A mutation in this gene was found in a family with sacral agenesis with vertebral anomalies. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 47.3 kDa |
| AA Sequence : | MSSPGTESAGKSLQYRVDHLLSAVENELQAGSEKGDPTERELRVGLEESELWLRFKELTNEMIVTKNGRR MFPVLKVNVSGLDPNAMYSFLLDFVAADNHRWKYVNGEWVPGGKPEPQAPSCVYIHPDSPNFGAHWMKAP VSFSKVKLTNKLNGGGQIMLNSLHKYEPRIHIVRVGGPQRMITSHCFPETQFIAVTAYQNEEITALKIKY NPFAKAFLDAKERSDHKEMMEEPGDSQQPGYSQSGGWLLPGTSTLCPPANPHPQFGGALSLPSTHSCDRY PTLRSHRSSPYPSPYAHRNNSPTYSDNSPACLSMLQSHDNWSSLGMPAHPSMLPVSHNASPPTSSSQYPS LWSVSNGAVTPGSQAAAVSNGLGAQFFRGSPAHYTPLTHPVSAPSSSGSPLYEGAAAATDIVDSQYDAAA QGRLIASWTPVSPPSMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | ES Cell Differentiation/IPS, Transcription Factors |
| Full Length : | Full L. |
| Gene Name | TBXT T-box transcription factor T [ Homo sapiens (human) ] |
| Official Symbol | TBXT |
| Synonyms | T; TFT; SAVA |
| Gene ID | 6862 |
| mRNA Refseq | NM_003181.4 |
| Protein Refseq | NP_003172.1 |
| MIM | 601397 |
| UniProt ID | O15178 |
| ◆ Recombinant Proteins | ||
| TBXT-2165H | Recombinant Human TBXT Protein, His (Fc)-Avi-tagged | +Inquiry |
| TBXT-261HFL | Recombinant Full Length Human TBXT Protein, C-Flag-tagged | +Inquiry |
| TBXT-6353H | Recombinant Human TBXT Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TBXT Products
Required fields are marked with *
My Review for All TBXT Products
Required fields are marked with *
