Recombinant Full Length Human TENT5A Protein, C-Flag-tagged
Cat.No. : | TENT5A-1592HFL |
Product Overview : | Recombinant Full Length Human TENT5A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables RNA binding activity. Predicted to be involved in mRNA stabilization. Predicted to act upstream of or within response to bacterium. Implicated in lung non-small cell carcinoma; osteoarthritis; and osteogenesis imperfecta type 18. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 49.5 kDa |
AA Sequence : | MAEGEGYFAMSEDELACSPYIPLGGDFGGGDFGGGDFGGGDFGGGGSFGGHCLDYCESPTAHCNVLNWEQ VQRLDGILSETIPIHGRGNFPTLELQPSLIVKVVRRRLAEKRIGVRDVRLNGSAASHVLHQDSGLGYKDL DLIFCADLRGEGEFQTVKDVVLDCLLDFLPEGVNKEKITPLTLKEAYVQKMVKVCNDSDRWSLISLSNNS GKNVELKFVDSLRRQFEFSVDSFQIKLDSLLLFYECSENPMTETFHPTIIGESVYGDFQEAFDHLCNKII ATRNPEEIRGGGLLKYCNLLVRGFRPASDEIKTLQRYMCSRFFIDFSDIGEQQRKLESYLQNHFVGLEDR KYEYLMTLHGVVNESTVCLMGHERRQTLNLITMLAIRVLADQNVIPNVANVTCYYQPAPYVADANFSNYY IAQVQPVFTCQQQTYSTWLPCNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | TENT5A terminal nucleotidyltransferase 5A [ Homo sapiens (human) ] |
Official Symbol | TENT5A |
Synonyms | OI18; XTP11; FAM46A; C6orf37 |
Gene ID | 55603 |
mRNA Refseq | NM_017633.3 |
Protein Refseq | NP_060103.2 |
MIM | 611357 |
UniProt ID | Q96IP4 |
◆ Recombinant Proteins | ||
Tent5a-6356M | Recombinant Mouse Tent5a Protein, Myc/DDK-tagged | +Inquiry |
TENT5A-2173H | Recombinant Human TENT5A Protein, His (Fc)-Avi-tagged | +Inquiry |
TENT5A-1592HFL | Recombinant Full Length Human TENT5A Protein, C-Flag-tagged | +Inquiry |
TENT5A-3039H | Recombinant Human TENT5A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TENT5A Products
Required fields are marked with *
My Review for All TENT5A Products
Required fields are marked with *
0
Inquiry Basket