Recombinant Full Length Human Testis-Specific Protein Tex28(Tex28) Protein, His-Tagged
Cat.No. : | RFL1742HF |
Product Overview : | Recombinant Full Length Human Testis-specific protein TEX28(TEX28) Protein (O15482) (1-410aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-410) |
Form : | Lyophilized powder |
AA Sequence : | MVLKAEHTRSPSATLPSNVPSCRSLSSSEDGPSGPSSLADGGLAHNLQDSVRHRILYLSE QLRVEKASRDGNTVSYLKLVSKADRHQVPHIQQAFEKVNQRASATIAQIEHRLHQCHQQL QELEEGCRPEGLLLMAESDPANCEPPSEKALLSEPPEPGGEDGPVNLPHASRPFILESRF QSLQQGTCLETEDVAQQQNLLLQKVKAELEEAKRFHISLQESYHSLKERSLTDLQLLLES LQEEKCRQALMEEQVNGRLQGQLNEIYNLKHNLACSEERMAYLSYERAKEIWEITETFKS RISKLEMLQQVTQLEAAEHLQSRPPQMLFKFLSPRLSLATVLLVFVSTLCACPSSLISSR LCTCTMLMLIGLGVLAWQRWRAIPATDWQEWVPSRCRLYSKDSGPPADGP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TEX28 |
Synonyms | TEX28; CXorf2; TEX28P1; TEX28P2; Testis-specific protein TEX28 |
UniProt ID | O15482 |
◆ Recombinant Proteins | ||
Tex28-6367M | Recombinant Mouse Tex28 Protein, Myc/DDK-tagged | +Inquiry |
TEX28-2330HF | Recombinant Full Length Human TEX28 Protein, GST-tagged | +Inquiry |
RFL1742HF | Recombinant Full Length Human Testis-Specific Protein Tex28(Tex28) Protein, His-Tagged | +Inquiry |
TEX28-3737H | Recombinant Human TEX28 protein, His-tagged | +Inquiry |
TEX28-2186H | Recombinant Human TEX28 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TEX28-1139HCL | Recombinant Human TEX28 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TEX28 Products
Required fields are marked with *
My Review for All TEX28 Products
Required fields are marked with *
0
Inquiry Basket