Recombinant Full Length Human Tetraspanin-5(Tspan5) Protein, His-Tagged
Cat.No. : | RFL10078HF |
Product Overview : | Recombinant Full Length Human Tetraspanin-5(TSPAN5) Protein (P62079) (1-268aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-268) |
Form : | Lyophilized powder |
AA Sequence : | MSGKHYKGPEVSCCIKYFIFGFNVIFWFLGITFLGIGLWAWNEKGVLSNISSITDLGGFD PVWLFLVVGGVMFILGFAGCIGALRENTFLLKFFSVFLGIIFFLELTAGVLAFVFKDWIK DQLYFFINNNIRAYRDDIDLQNLIDFTQEYWQCCGAFGADDWNLNIYFNCTDSNASRERC GVPFSCCTKDPAEDVINTQCGYDARQKPEVDQQIVIYTKGCVPQFEKWLQDNLTIVAGIF IGIALLQIFGICLAQNLVSDIEAVRASW |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TSPAN5 |
Synonyms | TSPAN5; TM4SF9; Tetraspanin-5; Tspan-5; Tetraspan NET-4; Transmembrane 4 superfamily member 9 |
UniProt ID | P62079 |
◆ Recombinant Proteins | ||
TSPAN5-3460H | Recombinant Human TSPAN5, GST-tagged | +Inquiry |
RFL5536BF | Recombinant Full Length Bovine Tetraspanin-5(Tspan5) Protein, His-Tagged | +Inquiry |
TSPAN5-17514M | Recombinant Mouse TSPAN5 Protein | +Inquiry |
TSPAN5-5003R | Recombinant Rhesus monkey TSPAN5 Protein, His-tagged | +Inquiry |
TSPAN5-4817R | Recombinant Rhesus Macaque TSPAN5 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TSPAN5-706HCL | Recombinant Human TSPAN5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TSPAN5 Products
Required fields are marked with *
My Review for All TSPAN5 Products
Required fields are marked with *