Recombinant Full Length Human Tetraspanin-7(Tspan7) Protein, His-Tagged
Cat.No. : | RFL26725HF |
Product Overview : | Recombinant Full Length Human Tetraspanin-7(TSPAN7) Protein (P41732) (1-249aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-249) |
Form : | Lyophilized powder |
AA Sequence : | MASRRMETKPVITCLKTLLIIYSFVFWITGVILLAVGVWGKLTLGTYISLIAENSTNAPY VLIGTGTTIVVFGLFGCFATCRGSPWMLKLYAMFLSLVFLAELVAGISGFVFRHEIKDTF LRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETD CNPQDLHNLTVAATKVNQKGCYDLVTSFMETNMGIIAGVAFGIAFSQLIGMLLACCLSRF ITANQYEMV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TSPAN7 |
Synonyms | A15; CCG B7; CD231; CD231 antigen; Cell surface glycoprotein A15; DXS1692E; Membrane component chromosome X surface marker 1; Membrane component X chromosome surface marker 1; MRX58; MXS1; T cell acute lymphoblastic leukemia associated antigen 1; T-cell a |
UniProt ID | P41732 |
◆ Recombinant Proteins | ||
TSPAN7-923M | Recombinant Mouse TSPAN7 Protein, His-tagged | +Inquiry |
TSPAN7-237H | Recombinant Human TSPAN7 protein | +Inquiry |
RFL27277MF | Recombinant Full Length Mouse Tetraspanin-7(Tspan7) Protein, His-Tagged | +Inquiry |
TSPAN7-1547H | Recombinant Human TSPAN7 Protein (113-223 aa), His-tagged | +Inquiry |
TSPAN7-4818R | Recombinant Rhesus Macaque TSPAN7 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TSPAN7-813CCL | Recombinant Cynomolgus TSPAN7 cell lysate | +Inquiry |
TSPAN7-863HCL | Recombinant Human TSPAN7 cell lysate | +Inquiry |
TSPAN7-861MCL | Recombinant Mouse TSPAN7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TSPAN7 Products
Required fields are marked with *
My Review for All TSPAN7 Products
Required fields are marked with *