Recombinant Human TSPAN7 Protein (113-213 aa), His-tagged

Cat.No. : TSPAN7-843H
Product Overview : Recombinant Human TSPAN7 Protein (113-213 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 113-213 aa
Description : May be involved in cell proliferation and cell motility.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 15.6 kDa
AA Sequence : RHEIKDTFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNM
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name TSPAN7 tetraspanin 7 [ Homo sapiens ]
Official Symbol TSPAN7
Synonyms TSPAN7; A15; CD231; DXS1692E; TALLA 1; tspan-7; CD231 antigen; MXS1; MRX58; CCG-B7; TM4SF2; TALLA-1; TM4SF2b;
Gene ID 7102
mRNA Refseq NM_004615
Protein Refseq NP_004606
MIM 300096
UniProt ID P41732

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TSPAN7 Products

Required fields are marked with *

My Review for All TSPAN7 Products

Required fields are marked with *

0
cart-icon