Recombinant Full Length Human TEX30 Protein, GST-tagged
Cat.No. : | TEX30-1776HF |
Product Overview : | Human C13orf27 full-length ORF ( NP_620134.2, 1 a.a. - 186 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 186 amino acids |
Description : | Predicted to enable hydrolase activity. |
Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 47.6 kDa |
AA Sequence : | MNLPHLMSLASHLASHGFFCLRFTCKGLNIVHRIKAYKSVLNYLKTSGEYKLAGVFLGGRSMGSRAAASVMCHIEPDDGDDFVRGLICISYPLHHPKQQHKLRDEDLFRLKEPVLFVSGSADEMCEKNLLEKVAQKMQAPHKIHWIEKANHSMAVKGRSTNDVFKEINTQILFWIQEITEMDKKCH |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | TEX30 testis expressed 30 [ Homo sapiens (human) ] |
Official Symbol | TEX30 |
Synonyms | C13orf27 |
Gene ID | 93081 |
mRNA Refseq | NM_138779.2 |
Protein Refseq | NP_620134.2 |
UniProt ID | Q5JUR7 |
◆ Recombinant Proteins | ||
TEX30-4674R | Recombinant Rhesus monkey TEX30 Protein, His-tagged | +Inquiry |
TEX30-654H | Recombinant Human TEX30 Protein, His-tagged | +Inquiry |
TEX30-4490R | Recombinant Rhesus Macaque TEX30 Protein, His (Fc)-Avi-tagged | +Inquiry |
TEX30-1776HF | Recombinant Full Length Human TEX30 Protein, GST-tagged | +Inquiry |
TEX30-525H | Recombinant Human TEX30 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TEX30-8301HCL | Recombinant Human C13orf27 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TEX30 Products
Required fields are marked with *
My Review for All TEX30 Products
Required fields are marked with *