Recombinant Full Length Human TGM1 Protein, C-Flag-tagged
Cat.No. : | TGM1-1420HFL |
Product Overview : | Recombinant Full Length Human TGM1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a membrane protein that catalyzes the addition of an alkyl group from an akylamine to a glutamine residue of a protein, forming an alkylglutamine in the protein. This protein alkylation leads to crosslinking of proteins and catenation of polyamines to proteins. This gene contains either one or two copies of a 22 nt repeat unit in its 3' UTR. Mutations in this gene have been associated with autosomal recessive lamellar ichthyosis (LI) and nonbullous congenital ichthyosiform erythroderma (NCIE). |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 89.6 kDa |
AA Sequence : | MMDGPRSDVGRWGGNPLQPPTTPSPEPEPEPDGRSRRGGGRSFWARCCGCCSCRNAADDDWGPEPSDSRG RGSSSGTRRPGSRGSDSRRPVSRGSGVNAAGDGTIREGMLVVNGVDLLSSRSDQNRREHHTDEYEYDELI VRRGQPFHMLLLLSRTYESSDRITLELLIGNNPEVGKGTHVIIPVGKGGSGGWKAQVVKASGQNLNLRVH TSPNAIIGKFQFTVRTQSDAGEFQLPFDPRNEIYILFNPWCPEDIVYVDHEDWRQEYVLNESGRIYYGTE AQIGERTWNYGQFDHGVLDACLYILDRRGMPYGGRGDPVNVSRVISAMVNSLDDNGVLIGNWSGDYSRGT NPSAWVGSVEILLSYLRTGYSVPYGQCWVFAGVTTTVLRCLGLATRTVTNFNSAHDTDTSLTMDIYFDEN MKPLEHLNHDSVWNFHVWNDCWMKRPDLPSGFDGWQVVDATPQETSSGIFCCGPCSVESIKNGLVYMKYD TPFIFAEVNSDKVYWQRQDDGSFKIVYVEEKAIGTLIVTKAISSNMREDITYLYKHPEGSDAERKAVETA AAHGSKPNVYANRGSAEDVAMQVEAQDAVMGQDLMVSVMLINHSSSRRTVKLHLYLSVTFYTGVSGTIFK ETKKEVELAPGASDRVTMPVAYKEYRPHLVDQGAMLLNVSGHVKESGQVLAKQHTFRLRTPDLSLTLLGA AVVGQECEVQIVFKNPLPVTLTNVVFRLEGSGLQRPKILNVGDIGGNETVTLRQSFVPVRPGPRQLIASL DSPQLSQVHGVIQVDVAPAPGDGGFFSDAGGDSHLGETIPMASRGGATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | TGM1 transglutaminase 1 [ Homo sapiens (human) ] |
Official Symbol | TGM1 |
Synonyms | LI; KTG; LI1; TGK; ICR2; ARCI1; TGASE |
Gene ID | 7051 |
mRNA Refseq | NM_000359.3 |
Protein Refseq | NP_000350.1 |
MIM | 190195 |
UniProt ID | P22735 |
◆ Recombinant Proteins | ||
TGM1-5698R | Recombinant Rat TGM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TGM1-2766H | Recombinant Human TGM1 Protein, His-tagged | +Inquiry |
Tgm1-1782M | Recombinant Mouse Tgm1 protein, His & GST-tagged | +Inquiry |
TGM1-6041R | Recombinant Rat TGM1 Protein | +Inquiry |
TGM1-1206H | Recombinant Human TGM1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TGM1-1111HCL | Recombinant Human TGM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TGM1 Products
Required fields are marked with *
My Review for All TGM1 Products
Required fields are marked with *
0
Inquiry Basket