Recombinant Full Length Human THEM4 Protein, C-Flag-tagged
Cat.No. : | THEM4-1469HFL |
Product Overview : | Recombinant Full Length Human THEM4 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Protein kinase B (PKB) is a major downstream target of receptor tyrosine kinases that signal via phosphatidylinositol 3-kinase. Upon cell stimulation, PKB is translocated to the plasma membrane, where it is phosphorylated in the C-terminal regulatory domain. The protein encoded by this gene negatively regulates PKB activity by inhibiting phosphorylation. Transcription of this gene is commonly downregulated in glioblastomas. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 26.9 kDa |
AA Sequence : | MLRSCAARLRTLGALCRPPVGRRLPGSEPRPELRSFSSEEVILKDCSVPNPSWNKDLRLLFDQFMKKCED GSWKRLPSYKRTPTEWIQDFKTHFLDPKLMKEEQMSQAQLFTRSFDDGLGFEYVMFYNDIEKRMVCLFQG GPYLEGPPGFIHGGAIATMIDATVGMCAMMAGGIVMTANLNINYKRPIPLCSVVMINSQLDKVEGRKFFV SCNVQSVDEKTLYSEATSLFIKLNPAKSLTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | THEM4 thioesterase superfamily member 4 [ Homo sapiens (human) ] |
Official Symbol | THEM4 |
Synonyms | CTMP |
Gene ID | 117145 |
mRNA Refseq | NM_053055.5 |
Protein Refseq | NP_444283.2 |
MIM | 606388 |
UniProt ID | Q5T1C6 |
◆ Recombinant Proteins | ||
THEM4-6050R | Recombinant Rat THEM4 Protein | +Inquiry |
Them4-6408M | Recombinant Mouse Them4 Protein, Myc/DDK-tagged | +Inquiry |
THEM4-9185M | Recombinant Mouse THEM4 Protein, His (Fc)-Avi-tagged | +Inquiry |
THEM4-16741M | Recombinant Mouse THEM4 Protein | +Inquiry |
THEM4-5707R | Recombinant Rat THEM4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
THEM4-1775HCL | Recombinant Human THEM4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All THEM4 Products
Required fields are marked with *
My Review for All THEM4 Products
Required fields are marked with *
0
Inquiry Basket