Recombinant Full Length Human Thromboxane-A Synthase(Tbxas1) Protein, His-Tagged
Cat.No. : | RFL14409HF |
Product Overview : | Recombinant Full Length Human Thromboxane-A synthase(TBXAS1) Protein (P24557) (1-533aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-533) |
Form : | Lyophilized powder |
AA Sequence : | MEALGFLKLEVNGPMVTVALSVALLALLKWYSTSAFSRLEKLGLRHPKPSPFIGNLTFFR QGFWESQMELRKLYGPLCGYYLGRRMFIVISEPDMIKQVLVENFSNFTNRMASGLEFKSV ADSVLFLRDKRWEEVRGALMSAFSPEKLNEMVPLISQACDLLLAHLKRYAESGDAFDIQR CYCNYTTDVVASVAFGTPVDSWQAPEDPFVKHCKRFFEFCIPRPILVLLLSFPSIMVPLA RILPNKNRDELNGFFNKLIRNVIALRDQQAAEERRRDFLQMVLDARHSASPMGVQDFDIV RDVFSSTGCKPNPSRQHQPSPMARPLTVDEIVGQAFIFLIAGYEIITNTLSFATYLLATN PDCQEKLLREVDVFKEKHMAPEFCSLEEGLPYLDMVIAETLRMYPPAFRFTREAAQDCEV LGQRIPAGAVLEMAVGALHHDPEHWPSPETFNPERFTAEARQQHRPFTYLPFGAGPRSCL GVRLGLLEVKLTLLHVLHKFRFQACPETQVPLQLESKSALGPKNGVYIKIVSR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TBXAS1 |
Synonyms | TBXAS1; CYP5; CYP5A1; TXAS; Thromboxane-A synthase; TXA synthase; TXS; Cytochrome P450 5A1; Hydroperoxy icosatetraenoate dehydratase |
UniProt ID | P24557 |
◆ Recombinant Proteins | ||
TBXAS1-3149H | Recombinant Human TBXAS1, MYC/DDK-tagged | +Inquiry |
TBXAS1-7843H | Recombinant Human TBXAS1 protein, His-tagged | +Inquiry |
TBXAS1-3147H | Recombinant Human TBXAS1, GST-tagged | +Inquiry |
TBXAS1-16537M | Recombinant Mouse TBXAS1 Protein | +Inquiry |
TBXAS1-3148H | Recombinant Human TBXAS1, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TBXAS1-1196HCL | Recombinant Human TBXAS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TBXAS1 Products
Required fields are marked with *
My Review for All TBXAS1 Products
Required fields are marked with *
0
Inquiry Basket