Recombinant Human TBXAS1 protein(381-460 aa), C-His-tagged
| Cat.No. : | TBXAS1-2701H |
| Product Overview : | Recombinant Human TBXAS1 protein(P24557)(381-460 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 381-460 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | PEFCSLEEGLPYLDMVIAETLRMYPPAFRFTREAAQDCEVLGQRIPAGAVLEMAVGALHHDPEHWPSPETFNPERFTAEA |
| Gene Name | TBXAS1 thromboxane A synthase 1 (platelet) [ Homo sapiens ] |
| Official Symbol | TBXAS1 |
| Synonyms | TBXAS1; thromboxane A synthase 1 (platelet); thromboxane A synthase 1 (platelet, cytochrome P450, subfamily V); thromboxane-A synthase; CYP5; CYP5A1; cytochrome P450; family 5; subfamily A; polypeptide 1; THAS; TS; TXAS; TXS; TXA synthase; cytochrome P450 5A1; platelet, cytochrome P450, subfamily V; cytochrome P450, family 5, subfamily A, polypeptide 1; thromboxane A synthase 1 (platelet, cytochrome P450, family 5, subfamily A); GHOSAL; BDPLT14; FLJ52771; |
| Gene ID | 6916 |
| mRNA Refseq | NM_001061 |
| Protein Refseq | NP_001052 |
| MIM | 274180 |
| UniProt ID | P24557 |
| ◆ Recombinant Proteins | ||
| TBXAS1-3148H | Recombinant Human TBXAS1, MYC/DDK-tagged | +Inquiry |
| TBXAS1-3007H | Recombinant Human TBXAS1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| TBXAS1-9066M | Recombinant Mouse TBXAS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TBXAS1-7843H | Recombinant Human TBXAS1 protein, His-tagged | +Inquiry |
| TBXAS1-3147H | Recombinant Human TBXAS1, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TBXAS1-1196HCL | Recombinant Human TBXAS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TBXAS1 Products
Required fields are marked with *
My Review for All TBXAS1 Products
Required fields are marked with *



