Recombinant Human TBXAS1 protein(381-460 aa), C-His-tagged

Cat.No. : TBXAS1-2701H
Product Overview : Recombinant Human TBXAS1 protein(P24557)(381-460 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 381-460 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : PEFCSLEEGLPYLDMVIAETLRMYPPAFRFTREAAQDCEVLGQRIPAGAVLEMAVGALHHDPEHWPSPETFNPERFTAEA
Gene Name TBXAS1 thromboxane A synthase 1 (platelet) [ Homo sapiens ]
Official Symbol TBXAS1
Synonyms TBXAS1; thromboxane A synthase 1 (platelet); thromboxane A synthase 1 (platelet, cytochrome P450, subfamily V); thromboxane-A synthase; CYP5; CYP5A1; cytochrome P450; family 5; subfamily A; polypeptide 1; THAS; TS; TXAS; TXS; TXA synthase; cytochrome P450 5A1; platelet, cytochrome P450, subfamily V; cytochrome P450, family 5, subfamily A, polypeptide 1; thromboxane A synthase 1 (platelet, cytochrome P450, family 5, subfamily A); GHOSAL; BDPLT14; FLJ52771;
Gene ID 6916
mRNA Refseq NM_001061
Protein Refseq NP_001052
MIM 274180
UniProt ID P24557

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TBXAS1 Products

Required fields are marked with *

My Review for All TBXAS1 Products

Required fields are marked with *

0
cart-icon