Recombinant Human TBXAS1 protein(381-460 aa), C-His-tagged
Cat.No. : | TBXAS1-2701H |
Product Overview : | Recombinant Human TBXAS1 protein(P24557)(381-460 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 381-460 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | PEFCSLEEGLPYLDMVIAETLRMYPPAFRFTREAAQDCEVLGQRIPAGAVLEMAVGALHHDPEHWPSPETFNPERFTAEA |
Gene Name | TBXAS1 thromboxane A synthase 1 (platelet) [ Homo sapiens ] |
Official Symbol | TBXAS1 |
Synonyms | TBXAS1; thromboxane A synthase 1 (platelet); thromboxane A synthase 1 (platelet, cytochrome P450, subfamily V); thromboxane-A synthase; CYP5; CYP5A1; cytochrome P450; family 5; subfamily A; polypeptide 1; THAS; TS; TXAS; TXS; TXA synthase; cytochrome P450 5A1; platelet, cytochrome P450, subfamily V; cytochrome P450, family 5, subfamily A, polypeptide 1; thromboxane A synthase 1 (platelet, cytochrome P450, family 5, subfamily A); GHOSAL; BDPLT14; FLJ52771; |
Gene ID | 6916 |
mRNA Refseq | NM_001061 |
Protein Refseq | NP_001052 |
MIM | 274180 |
UniProt ID | P24557 |
◆ Recombinant Proteins | ||
TBXAS1-8081H | Recombinant Human TBXAS1 protein, His & T7-tagged | +Inquiry |
TBXAS1-2701H | Recombinant Human TBXAS1 protein(381-460 aa), C-His-tagged | +Inquiry |
Tbxas1-6324M | Recombinant Mouse Tbxas1 Protein, Myc/DDK-tagged | +Inquiry |
TBXAS1-11646Z | Recombinant Zebrafish TBXAS1 | +Inquiry |
TBXAS1-7842H | Recombinant Human TBXAS1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TBXAS1-1196HCL | Recombinant Human TBXAS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TBXAS1 Products
Required fields are marked with *
My Review for All TBXAS1 Products
Required fields are marked with *