Recombinant Full Length Human TKFC Protein, C-Flag-tagged
Cat.No. : | TKFC-1641HFL |
Product Overview : | Recombinant Full Length Human TKFC Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene is a member of the family of dihydroxyacetone kinases, which have a protein structure distinct from other kinases. The product of this gene phosphorylates dihydroxyacetone, and also catalyzes the formation of riboflavin 4',5'-phosphate (aka cyclin FMN) from FAD. Several alternatively spliced transcript variants have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 58.8 kDa |
AA Sequence : | MTSKKLVNSVAGCADDALAGLVACNPNLQLLQGHRVALRSDLDSLKGRVALLSGGGSGHEPAHAGFIGKG MLTGVIAGAVFTSPAVGSILAAIRAVAQAGTVGTLLIVKNYTGDRLNFGLAREQARAEGIPVEMVVIGDD SAFTVLKKAGRRGLCGTVLIHKVAGALAEAGVGLEEIAKQVNVVAKAMGTLGVSLSSCSVPGSKPTFELS ADEVELGLGIHGEAGVRRIKMATADEIVKLMLDHMTNTTNASHVPVQPGSSVVMMVNNLGGLSFLELGII ADATVRSLEGRGVKIARALVGTFMSALEMPGISLTLLLVDEPLLKLIDAETTAAAWPNVAAVSITGRKRS RVAPAEPQEAPDSTAAGGSASKRMALVLERVCSTLLGLEEHLNALDRAAGDGDCGTTHSRAARAIQEWLK EGPPPASPAQLLSKLSVLLLEKMGGSSGALYGLFLTAAAQPLKAKTSLPAWSAAMDAGLEAMQKYGKAAP GDRTMLDSLWAAGQELQAWKSPGADLLQVLTKAVKSAEAAAEATKNMEAGAGRASYISSARLEQPDPGAV AAAAILRAILEVLQSSGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Glycerolipid metabolism, Metabolic pathways, RIG-I-like receptor signaling pathway |
Full Length : | Full L. |
Gene Name | TKFC triokinase and FMN cyclase [ Homo sapiens (human) ] |
Official Symbol | TKFC |
Synonyms | DAK; NET45; TKFCD |
Gene ID | 26007 |
mRNA Refseq | NM_015533.4 |
Protein Refseq | NP_056348.2 |
MIM | 615844 |
UniProt ID | Q3LXA3 |
◆ Recombinant Proteins | ||
TKFC-1113H | Recombinant Human TKFC Protein, MYC/DDK-tagged | +Inquiry |
TKFC-3462H | Recombinant Human TKFC Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TKFC-1641HFL | Recombinant Full Length Human TKFC Protein, C-Flag-tagged | +Inquiry |
TKFC-2655H | Recombinant Human TKFC Protein, GST-tagged | +Inquiry |
TKFC-3926HF | Recombinant Full Length Human TKFC Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TKFC Products
Required fields are marked with *
My Review for All TKFC Products
Required fields are marked with *