Recombinant Full Length Human TMEM258 Protein, GST-tagged
| Cat.No. : | TMEM258-1795HF |
| Product Overview : | Human TMEM258 full-length ORF (NP_055021.1, 1 a.a. - 79 a.a.) recombinant protein with GST tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 79 amino acids |
| Description : | Involved in protein N-linked glycosylation. Located in endoplasmic reticulum. Part of oligosaccharyltransferase I complex. |
| Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 35.09 kDa |
| AA Sequence : | MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVASLFMGFGVLFLLLWVGIYV |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | TMEM258 transmembrane protein 258 [ Homo sapiens (human) ] |
| Official Symbol | TMEM258 |
| Synonyms | C11orf10; Kuduk; Kud; Dolichyl-Diphosphooligosaccharide-Protein Glycosyltransferase Subunit TMEM258; Oligosaccharyl Transferase Subunit TMEM258; UPF0197 Transmembrane Protein C11orf10; Chromosome 11 Open Reading Frame 10 |
| Gene ID | 746 |
| mRNA Refseq | NM_014206.3 |
| Protein Refseq | NP_055021.1 |
| MIM | 617615 |
| UniProt ID | P61165 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMEM258 Products
Required fields are marked with *
My Review for All TMEM258 Products
Required fields are marked with *
Recently Viewed
