Recombinant Full Length Human TMEM258 Protein, GST-tagged

• Cat.No.: TMEM258-1795HF
• Product Overview: Human TMEM258 full-length ORF (NP_055021.1, 1 a.a. - 79 a.a.) recombinant protein with GST tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 79 amino acids
• Description: Involved in protein N-linked glycosylation. Located in endoplasmic reticulum. Part of oligosaccharyltransferase I complex.
• Form: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 35.09 kDa
• AA Sequence: MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVASLFMGFGVLFLLLWVGIYV
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: TMEM258 transmembrane protein 258 [ Homo sapiens (human) ]
• Official Symbol: TMEM258
• Synonyms: C11orf10; Kuduk; Kud; Dolichyl-Diphosphooligosaccharide-Protein Glycosyltransferase Subunit TMEM258; Oligosaccharyl Transferase Subunit TMEM258; UPF0197 Transmembrane Protein C11orf10; Chromosome 11 Open Reading Frame 10
• Gene ID: 746
• mRNA Refseq: NM_014206.3
• Protein Refseq: NP_055021.1
• MIM: 617615
• UniProt ID: P61165