Recombinant Full Length Human TMEM33 Protein, N-GST-tagged
Cat.No. : | TMEM33-15HFL |
Product Overview : | Recombinant Full Length Human TMEM33 Protein, fused to GST-tag at N-terminus, was expressed in Wheat Germ (in vitro). |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-247 aa |
Description : | Involved in positive regulation of endoplasmic reticulum unfolded protein response; regulation of endoplasmic reticulum tubular network organization; and response to endoplasmic reticulum stress. Located in endoplasmic reticulum membrane; melanosome; and nuclear envelope. Is integral component of endoplasmic reticulum membrane. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 54.4 kDa |
AA Sequence : | MADTTPNGPQGAGAVQFMMTNKLDTAMWLSRLFTVYCSALFVLPLLGLHEAASFYQRALLANALTSALRLHQRLPHFQLSRAFLAQALLEDSCHYLLYSLIFVNSYPVTMSIFPVLLFSLLHAATYTKKVLDARGSNSLPLLRSVLDKLSANQQNILKFIACNEIFLMPATVFMLFSGQGSLLQPFIYYRFLTLRYSSRRNPYCRTLFNELRIVVEHIIMKPACPLFVRRLCLQSIAFISRLAPTVP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | TMEM33 transmembrane protein 33 [ Homo sapiens (human) ] |
Official Symbol | TMEM33 |
Synonyms | TMEM33; transmembrane protein 33; Pom33; SHINC3; SHINC-3; 1600019D15Rik; FLJ10525; TMEM33-15HFL |
Gene ID | 55161 |
mRNA Refseq | NM_018126.3 |
Protein Refseq | NP_060596.2 |
MIM | 618515 |
UniProt ID | P57088 |
◆ Recombinant Proteins | ||
RFL12558MF | Recombinant Full Length Mouse Transmembrane Protein 33(Tmem33) Protein, His-Tagged | +Inquiry |
TMEM33-17034M | Recombinant Mouse TMEM33 Protein | +Inquiry |
RFL23468DF | Recombinant Full Length Dictyostelium Discoideum Transmembrane Protein 33 Homolog(Tmem33) Protein, His-Tagged | +Inquiry |
TMEM33-4635R | Recombinant Rhesus Macaque TMEM33 Protein, His (Fc)-Avi-tagged | +Inquiry |
TMEM33-12710Z | Recombinant Zebrafish TMEM33 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM33-957HCL | Recombinant Human TMEM33 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMEM33 Products
Required fields are marked with *
My Review for All TMEM33 Products
Required fields are marked with *
0
Inquiry Basket