Recombinant Full Length Human TMEM33 Protein, N-GST-tagged

• Cat.No.: TMEM33-15HFL
• Product Overview: Recombinant Full Length Human TMEM33 Protein, fused to GST-tag at N-terminus, was expressed in Wheat Germ (in vitro).

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1-247 aa
• Description: Involved in positive regulation of endoplasmic reticulum unfolded protein response; regulation of endoplasmic reticulum tubular network organization; and response to endoplasmic reticulum stress. Located in endoplasmic reticulum membrane; melanosome; and nuclear envelope. Is integral component of endoplasmic reticulum membrane.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 54.4 kDa
• AA Sequence: MADTTPNGPQGAGAVQFMMTNKLDTAMWLSRLFTVYCSALFVLPLLGLHEAASFYQRALLANALTSALRLHQRLPHFQLSRAFLAQALLEDSCHYLLYSLIFVNSYPVTMSIFPVLLFSLLHAATYTKKVLDARGSNSLPLLRSVLDKLSANQQNILKFIACNEIFLMPATVFMLFSGQGSLLQPFIYYRFLTLRYSSRRNPYCRTLFNELRIVVEHIIMKPACPLFVRRLCLQSIAFISRLAPTVP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: TMEM33 transmembrane protein 33 [ Homo sapiens (human) ]
• Official Symbol: TMEM33
• Synonyms: TMEM33; transmembrane protein 33; Pom33; SHINC3; SHINC-3; 1600019D15Rik; FLJ10525; TMEM33-15HFL
• Gene ID: 55161
• mRNA Refseq: NM_018126.3
• Protein Refseq: NP_060596.2
• MIM: 618515
• UniProt ID: P57088