Recombinant Full Length Human TMEM97 Protein, C-Flag-tagged

• Cat.No.: TMEM97-1132HFL
• Product Overview: Recombinant Full Length Human TMEM97 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: TMEM97 is a conserved integral membrane protein that plays a role in controlling cellular cholesterol levels.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 20.7 kDa
• AA Sequence: MGAPATRRCVEWLLGLYFLSHIPITLFMDLQAVLPRELYPVEFRNLLKWYAKEFKDPLLQEPPAWFKSFL FCELVFQLPFFPIATYAFLKGSCKWIRTPAIIYSVHTMTTLIPILSTFLFEDFSKASGFKGQRPETLHER
  LTLVSVYAPYLLIPFILLIFMLRSPYYKYEEKRKKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Transmembrane
• Full Length: Full L.

Gene Information

• Gene Name: TMEM97 transmembrane protein 97 [ Homo sapiens (human) ]
• Official Symbol: TMEM97
• Synonyms: MAC30; sigma2R
• Gene ID: 27346
• mRNA Refseq: NM_014573.3
• Protein Refseq: NP_055388.2
• MIM: 612912
• UniProt ID: Q5BJF2