Recombinant Full Length Human TMIE Protein, C-Flag-tagged
| Cat.No. : | TMIE-733HFL |
| Product Overview : | Recombinant Full Length Human TMIE Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | This gene encodes a transmembrane inner ear protein. Studies in mouse suggest that this gene is required for normal postnatal maturation of sensory hair cells in the cochlea, including correct development of stereocilia bundles. This gene is one of multiple genes responsible for recessive non-syndromic deafness (DFNB), also known as autosomal recessive nonsyndromic hearing loss (ARNSHL), the most common form of congenitally acquired inherited hearing impairment. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 14.8 kDa |
| AA Sequence : | MAGWPGAGPLCVLGGAALGVCLAGVAGQLVEPSTAPPKPKPPPLTKETVVFWDMRLWHVVGIFSLFVLSI IITLCCVFNCRVPRTRKEIEARYLQRKAAKMYTDKLETVPPLNELTEVPGEDKKKKKKKKDSVDTVAIKV EEDEKNEAKKKKGEKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Transmembrane |
| Full Length : | Full L. |
| Gene Name | TMIE transmembrane inner ear [ Homo sapiens (human) ] |
| Official Symbol | TMIE |
| Synonyms | DFNB6 |
| Gene ID | 259236 |
| mRNA Refseq | NM_147196.3 |
| Protein Refseq | NP_671729.2 |
| MIM | 607237 |
| UniProt ID | Q8NEW7 |
| ◆ Recombinant Proteins | ||
| TMIE-4586H | Recombinant Human TMIE Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| TMIE-2860H | Recombinant Human TMIE protein, His-tagged | +Inquiry |
| TMIE-2111H | Recombinant Human TMIE protein, GST-tagged | +Inquiry |
| TMIE-7650Z | Recombinant Zebrafish TMIE | +Inquiry |
| Tmie-6520M | Recombinant Mouse Tmie Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMIE Products
Required fields are marked with *
My Review for All TMIE Products
Required fields are marked with *



