Recombinant Human TMIE protein, His-tagged
Cat.No. : | TMIE-2860H |
Product Overview : | Recombinant Human TMIE protein(79-156 aa), fused with N-terminal His tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | His |
Protein Length : | 79-156 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | NCRVPRTRKEIEARYLQRKAAKMYTDKLETVPPLNELTEVPGEDKKKKKKKKDSVDTVAIKVEEDEKNEAKKKKGEK |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | TMIE transmembrane inner ear [ Homo sapiens ] |
Official Symbol | TMIE |
Synonyms | TMIE; transmembrane inner ear; deafness, autosomal recessive 6 , DFNB6; transmembrane inner ear expressed protein; transmembrane inner ear protein; DFNB6; |
mRNA Refseq | NM_147196 |
Protein Refseq | NP_671729 |
MIM | 607237 |
UniProt ID | Q8NEW7 |
Gene ID | 259236 |
◆ Recombinant Proteins | ||
TMIE-4586H | Recombinant Human TMIE Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TMIE-2860H | Recombinant Human TMIE protein, His-tagged | +Inquiry |
TMIE-7650Z | Recombinant Zebrafish TMIE | +Inquiry |
Tmie-6520M | Recombinant Mouse Tmie Protein, Myc/DDK-tagged | +Inquiry |
TMIE-733HFL | Recombinant Full Length Human TMIE Protein, C-Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMIE Products
Required fields are marked with *
My Review for All TMIE Products
Required fields are marked with *
0
Inquiry Basket