Recombinant Full Length Human TMSB15A Protein, C-Flag-tagged

Cat.No. : TMSB15A-1995HFL
Product Overview : Recombinant Full Length Human TMSB15A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : Predicted to enable actin monomer binding activity. Involved in positive regulation of cell migration. Predicted to be located in cytoskeleton. Predicted to be active in cytoplasm.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 5 kDa
AA Sequence : MSDKPDLSEVEKFDRSKLKKTNTEEKNTLPSKETIQQEKECVQTS myc-FLAG tag
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Full Length : Full L.
Gene Name TMSB15A thymosin beta 15A [ Homo sapiens (human) ]
Official Symbol TMSB15A
Synonyms Tb15; TbNB; TMSL8; TMSNB; TMSB15; TMSB15B
Gene ID 11013
mRNA Refseq NM_021992.3
Protein Refseq NP_068832.1
MIM 300939
UniProt ID P0CG34

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TMSB15A Products

Required fields are marked with *

My Review for All TMSB15A Products

Required fields are marked with *

0
cart-icon