Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Full Length Human TMSB15A Protein, C-Flag-tagged

Cat.No. : TMSB15A-1995HFL
Product Overview : Recombinant Full Length Human TMSB15A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
Description : Predicted to enable actin monomer binding activity. Involved in positive regulation of cell migration. Predicted to be located in cytoskeleton. Predicted to be active in cytoplasm.
Source : Mammalian cells
Species : Human
Tag : Flag
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 5 kDa
AA Sequence : MSDKPDLSEVEKFDRSKLKKTNTEEKNTLPSKETIQQEKECVQTS myc-FLAG tag
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Gene Name : TMSB15A thymosin beta 15A [ Homo sapiens (human) ]
Official Symbol : TMSB15A
Synonyms : Tb15; TbNB; TMSL8; TMSNB; TMSB15; TMSB15B
Gene ID : 11013
mRNA Refseq : NM_021992.3
Protein Refseq : NP_068832.1
MIM : 300939
UniProt ID : P0CG34

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends