Recombinant Full Length Human TMSB15A Protein, C-Flag-tagged
Cat.No. : | TMSB15A-1995HFL |
Product Overview : | Recombinant Full Length Human TMSB15A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to enable actin monomer binding activity. Involved in positive regulation of cell migration. Predicted to be located in cytoskeleton. Predicted to be active in cytoplasm. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 5 kDa |
AA Sequence : | MSDKPDLSEVEKFDRSKLKKTNTEEKNTLPSKETIQQEKECVQTS myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | TMSB15A thymosin beta 15A [ Homo sapiens (human) ] |
Official Symbol | TMSB15A |
Synonyms | Tb15; TbNB; TMSL8; TMSNB; TMSB15; TMSB15B |
Gene ID | 11013 |
mRNA Refseq | NM_021992.3 |
Protein Refseq | NP_068832.1 |
MIM | 300939 |
UniProt ID | P0CG34 |
◆ Recombinant Proteins | ||
TMSB15A-2214H | Recombinant Human TMSB15A Protein, His (Fc)-Avi-tagged | +Inquiry |
TMSB15A-1995HFL | Recombinant Full Length Human TMSB15A Protein, C-Flag-tagged | +Inquiry |
TMSB15A-102H | Recombinant Human TMSB15A protein, His-tagged | +Inquiry |
Tmsb15a-6530M | Recombinant Mouse Tmsb15a Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMSB15A Products
Required fields are marked with *
My Review for All TMSB15A Products
Required fields are marked with *