Recombinant Full Length Human TMSB15A Protein, C-Flag-tagged
Cat.No. : | TMSB15A-1995HFL |
Product Overview : | Recombinant Full Length Human TMSB15A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
Description : | Predicted to enable actin monomer binding activity. Involved in positive regulation of cell migration. Predicted to be located in cytoskeleton. Predicted to be active in cytoplasm. |
Source : | Mammalian cells |
Species : | Human |
Tag : | Flag |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 5 kDa |
AA Sequence : | MSDKPDLSEVEKFDRSKLKKTNTEEKNTLPSKETIQQEKECVQTS myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Gene Name : | TMSB15A thymosin beta 15A [ Homo sapiens (human) ] |
Official Symbol : | TMSB15A |
Synonyms : | Tb15; TbNB; TMSL8; TMSNB; TMSB15; TMSB15B |
Gene ID : | 11013 |
mRNA Refseq : | NM_021992.3 |
Protein Refseq : | NP_068832.1 |
MIM : | 300939 |
UniProt ID : | P0CG34 |
Products Types
◆ Recombinant Protein | ||
TMSB15A-2214H | Recombinant Human TMSB15A Protein, His (Fc)-Avi-tagged | +Inquiry |
Tmsb15a-6530M | Recombinant Mouse Tmsb15a Protein, Myc/DDK-tagged | +Inquiry |
TMSB15A-102H | Recombinant Human TMSB15A protein, His-tagged | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket