Recombinant Full Length Human TMSB15A Protein, C-Flag-tagged

• Cat.No.: TMSB15A-1995HFL
• Product Overview: Recombinant Full Length Human TMSB15A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: Predicted to enable actin monomer binding activity. Involved in positive regulation of cell migration. Predicted to be located in cytoskeleton. Predicted to be active in cytoplasm.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 5 kDa
• AA Sequence: MSDKPDLSEVEKFDRSKLKKTNTEEKNTLPSKETIQQEKECVQTS myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Full Length: Full L.

Gene Information

• Gene Name: TMSB15A thymosin beta 15A [ Homo sapiens (human) ]
• Official Symbol: TMSB15A
• Synonyms: Tb15; TbNB; TMSL8; TMSNB; TMSB15; TMSB15B
• Gene ID: 11013
• mRNA Refseq: NM_021992.3
• Protein Refseq: NP_068832.1
• MIM: 300939
• UniProt ID: P0CG34