Recombinant Full Length Human TMX4 Protein, C-Myc/DDK-tagged

Cat.No. : TMX4-13HFL
Product Overview : Recombinant Full Length Human TMX4 Protein, fused to Myc/DDK-tag at C-terminus, was expressed in HEK293T.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, a catalytically active thioredoxin domain, one transmembrane domain and C-terminal ASP/GLU-rich calcium binding domain. Unlike most members of this gene family, it lacks a C-terminal ER-retention sequence. The encoded protein has been shown to have reductase activity in vitro.
Form : 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol.
Molecular Mass : 38.8 kDa
AA Sequence : MAGGRCGPQLTALLAAWIAAVAATAGPEEAALPPEQSRVQPMTASNWTLVMEGEWMLKFYAPWCPSCQQT DSEWEAFAKNGEILQISVGKVDVIQEPGLSGRFFVTTLPAFFHAKDGIFRRYRGPGIFEDLQNYILEKKW QSVEPLTGWKSPASLTMSGMAGLFSISGKIWHLHNYFTVTLGIPAWCSYVFFVIATLVFGLFMGLVLVVI SECFYVPLPRHLSERSEQNRRSEEAHRAEQLQDAEEEKDDSNEEENKDSLVDDEEEKEDLGDEDEAEEEE EEDNLAAGVDEERSEANDQGPPGEDGVTREEVEPEEAEEGISEQPCPADTEVVEDSLRQRKSQHADKGL myc-FLAG tag
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Notes : For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >0.05 µg/µL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Druggable Genome, Transmembrane
Full Length : Full L.
Gene Name TMX4 thioredoxin related transmembrane protein 4 [ Homo sapiens (human) ]
Official Symbol TMX4
Synonyms PDIA14; TXNDC13; DJ971N18.2
Gene ID 56255
mRNA Refseq NM_021156.4
Protein Refseq NP_066979.2
MIM 616766
UniProt ID Q9H1E5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TMX4 Products

Required fields are marked with *

My Review for All TMX4 Products

Required fields are marked with *

0
cart-icon
0
compare icon