Recombinant Full Length Human TNFRSF4 Protein, C-Flag-tagged
Cat.No. : | TNFRSF4-982HFL |
Product Overview : | Recombinant Full Length Human TNFRSF4 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been shown to activate NF-kappaB through its interaction with adaptor proteins TRAF2 and TRAF5. Knockout studies in mice suggested that this receptor promotes the expression of apoptosis inhibitors BCL2 and BCL2lL1/BCL2-XL, and thus suppresses apoptosis. The knockout studies also suggested the roles of this receptor in CD4+ T cell response, as well as in T cell-dependent B cell proliferation and differentiation. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 26.6 kDa |
AA Sequence : | MCVGARRLGRGPCAALLLLGLGLSTVTGLHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPG FYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQA CKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVP GGRAVAAILGLGLVLGLLGPLAILLALYLLRRDQRLPPDAHKPPGGGSFRTPIQEEQADAHSTLAKITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Protein Pathways : | Cytokine-cytokine receptor interaction |
Full Length : | Full L. |
Gene Name | TNFRSF4 TNF receptor superfamily member 4 [ Homo sapiens (human) ] |
Official Symbol | TNFRSF4 |
Synonyms | OX40; ACT35; CD134; IMD16; TXGP1L |
Gene ID | 7293 |
mRNA Refseq | NM_003327.4 |
Protein Refseq | NP_003318.1 |
MIM | 600315 |
UniProt ID | P43489 |
◆ Recombinant Proteins | ||
TNFRSF4-2764H | Recombinant Human TNFRSF4 protein(141-210 aa), C-His-tagged | +Inquiry |
TNFRSF4-1907R | Recombinant Rabbit TNFRSF4 protein, His-tagged | +Inquiry |
TNFRSF4-152H | Recombinant Human TNFRSF4 Protein, DYKDDDDK-tagged | +Inquiry |
TNFRSF4-548RAF488 | Recombinant Monkey TNFRSF4 Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
Tnfrsf4-547MAF647 | Recombinant Mouse Tnfrsf4 Protein, Alexa Fluor 647 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF4-2422HCL | Recombinant Human TNFRSF4 cell lysate | +Inquiry |
TNFRSF4-1762MCL | Recombinant Mouse TNFRSF4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNFRSF4 Products
Required fields are marked with *
My Review for All TNFRSF4 Products
Required fields are marked with *
0
Inquiry Basket