Recombinant Full Length Human TOLLIP Protein, C-Flag-tagged
Cat.No. : | TOLLIP-1594HFL |
Product Overview : | Recombinant Full Length Human TOLLIP Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a ubiquitin-binding protein that interacts with several Toll-like receptor (TLR) signaling cascade components. The encoded protein regulates inflammatory signaling and is involved in interleukin-1 receptor trafficking and in the turnover of IL1R-associated kinase. Several transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 30.1 kDa |
AA Sequence : | MATTVSTQRGPVYIGELPQDFLRITPTQQQRQVQLDAQAAQQLQYGGAVGTVGRLNITVVQAKLAKNYGM TRMDPYCRLRLGYAVYETPTAHNGAKNPRWNKVIHCTVPPGVDSFYLEIFDERAFSMDDRIAWTHITIPE SLRQGKVEDKWYSLSGRQGDDKEGMINLVMSYALLPAAMVMPPQPVVLMPTVYQQGVGYVPITGMPAVCS PGMVPVALPPAAVNAQPRCSEEDLKAIQDMFPNMDQEVIRSVLEAQRGNKDAAINSLLQMGEEPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Toll-like receptor signaling pathway |
Full Length : | Full L. |
Gene Name | TOLLIP toll interacting protein [ Homo sapiens (human) ] |
Official Symbol | TOLLIP |
Synonyms | IL-1RAcPIP |
Gene ID | 54472 |
mRNA Refseq | NM_019009.4 |
Protein Refseq | NP_061882.2 |
MIM | 606277 |
UniProt ID | Q9H0E2 |
◆ Recombinant Proteins | ||
TOLLIP-1610C | Recombinant Chicken TOLLIP | +Inquiry |
Tollip-8083M | Recombinant Mouse Tollip protein, His & T7-tagged | +Inquiry |
TOLLIP-4888R | Recombinant Rhesus monkey TOLLIP Protein, His-tagged | +Inquiry |
TOLLIP-3533H | Recombinant Human Toll Interacting Protein, His-tagged | +Inquiry |
TOLLIP-11793Z | Recombinant Zebrafish TOLLIP | +Inquiry |
◆ Cell & Tissue Lysates | ||
TOLLIP-1806HCL | Recombinant Human TOLLIP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TOLLIP Products
Required fields are marked with *
My Review for All TOLLIP Products
Required fields are marked with *
0
Inquiry Basket