Recombinant Full Length Human TOMM22 Protein, GST-tagged

Cat.No. : TOMM22-6861HF
Product Overview : Human TOMM22 full-length ORF ( AAH09363, 1 a.a. - 142 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 142 amino acids
Description : The protein encoded by this gene is an integral membrane protein of the mitochondrial outer membrane. The encoded protein interacts with TOMM20 and TOMM40, and forms a complex with several other proteins to import cytosolic preproteins into the mitochondrion.
Molecular Mass : 41.36 kDa
AA Sequence : MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPSLPGKI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name TOMM22 translocase of outer mitochondrial membrane 22 [ Homo sapiens (human) ]
Official Symbol TOMM22
Synonyms TOMM22; translocase of outer mitochondrial membrane 22; 1C9-2; TOM22; MST065; MSTP065; mitochondrial import receptor subunit TOM22 homolog; mitochondrial import receptor Tom22; translocase of outer membrane 22 kDa subunit homolog; translocase of outer mitochondrial membrane 22 homolog
Gene ID 56993
mRNA Refseq NM_020243
Protein Refseq NP_064628
MIM 607046
UniProt ID Q9NS69

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TOMM22 Products

Required fields are marked with *

My Review for All TOMM22 Products

Required fields are marked with *

0
cart-icon