Recombinant Full Length Human TOR4A Protein, GST-tagged
| Cat.No. : | TOR4A-3547HF |
| Product Overview : | Human C9orf167 full-length ORF (BAA91032.1, 1 a.a. - 423 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 423 amino acids |
| Description : | TOR4A (Torsin Family 4 Member A) is a Protein Coding gene. Among its related pathways are Response to elevated platelet cytosolic Ca2+. An important paralog of this gene is TOR3A. |
| Molecular Mass : | 73.3 kDa |
| AA Sequence : | MDRGQPSLEPAAAAPRASGRCVIAPVRAVLRLRRRVCVLRKRRLLQPGGGPDVGTGAPRPGCSPRAPRADLDQPKFFTFDSPAELPSRTPRKKRRRSRLVLYPETSRKYRPRVEHRSRAQRCLLLLVAIVGFQVLNAIENLDDNAQRYDLDGLEKALQRAVFGQPAAVSRIVALMRDYLATHVHSRPLLLALYGPSGVGKSHVGRLLARHFRSVLEDSALVLQYHARHHCPEARAAQDCREELARRVADVVARAEAEEKTPLLVLDDVELMPRPLLDELHGFLQPQRSHHFHNAIYVLLSGAGGAEVTRFVLQNASRALPLRPDGFRSAEAAAAQAEEDLRASLLAVLSREHPLWRAAAIVPFLLLDKRDVVSCFRDEMAGEGFFPDQARAENLAAQLSFYRVAGREFAVTGCKQVVATVNLL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | TOR4A torsin family 4, member A [ Homo sapiens ] |
| Official Symbol | TOR4A |
| Synonyms | C9orf167; RP13-122B23.4 |
| Gene ID | 54863 |
| mRNA Refseq | NM_017723 |
| Protein Refseq | NP_060193 |
| UniProt ID | Q9NXH8 |
| ◆ Recombinant Proteins | ||
| RFL23507MF | Recombinant Full Length Mouse Torsin-4A(Tor4A) Protein, His-Tagged | +Inquiry |
| TOR4A-3547HF | Recombinant Full Length Human TOR4A Protein, GST-tagged | +Inquiry |
| RFL22945XF | Recombinant Full Length Xenopus Tropicalis Torsin-4A(Tor4A) Protein, His-Tagged | +Inquiry |
| RFL18338DF | Recombinant Full Length Danio Rerio Torsin-4A(Tor4A) Protein, His-Tagged | +Inquiry |
| TOR4A-0192H | Recombinant Human TOR4A Protein, GST-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TOR4A Products
Required fields are marked with *
My Review for All TOR4A Products
Required fields are marked with *
