Recombinant Full Length Human Trace Amine-Associated Receptor 6(Taar6) Protein, His-Tagged
Cat.No. : | RFL21343HF |
Product Overview : | Recombinant Full Length Human Trace amine-associated receptor 6(TAAR6) Protein (Q96RI8) (1-345aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-345) |
Form : | Lyophilized powder |
AA Sequence : | MSSNSSLLVAVQLCYANVNGSCVKIPFSPGSRVILYIVFGFGAVLAVFGNLLVMISILHF KQLHSPTNFLVASLACADFLVGVTVMPFSMVRTVESCWYFGRSFCTFHTCCDVAFCYSSL FHLCFISIDRYIAVTDPLVYPTKFTVSVSGICISVSWILPLMYSGAVFYTGVYDDGLEEL SDALNCIGGCQTVVNQNWVLTDFLSFFIPTFIMIILYGNIFLVARRQAKKIENTGSKTES SSESYKARVARRERKAAKTLGVTVVAFMISWLPYSIDSLIDAFMGFITPACIYEICCWCA YYNSAMNPLIYALFYPWFRKAIKVIVTGQVLKNSSATMNLFSEHI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TAAR6 |
Synonyms | TAAR6; TA4; TAR4; TRAR4; Trace amine-associated receptor 6; TaR-6; Trace amine receptor 6; Trace amine receptor 4; TaR-4 |
UniProt ID | Q96RI8 |
◆ Recombinant Proteins | ||
TAAR6-6809HF | Recombinant Full Length Human TAAR6 Protein, GST-tagged | +Inquiry |
TAAR6-676H | Recombinant Human TAAR6 Protein | +Inquiry |
TAAR6-5891R | Recombinant Rat TAAR6 Protein | +Inquiry |
RFL21343HF | Recombinant Full Length Human Trace Amine-Associated Receptor 6(Taar6) Protein, His-Tagged | +Inquiry |
TAAR6-16356M | Recombinant Mouse TAAR6 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TAAR6 Products
Required fields are marked with *
My Review for All TAAR6 Products
Required fields are marked with *
0
Inquiry Basket