Recombinant Full Length Human Transmembrane 4 L6 Family Member 1(Tm4Sf1) Protein, His-Tagged
Cat.No. : | RFL10548HF |
Product Overview : | Recombinant Full Length Human Transmembrane 4 L6 family member 1(TM4SF1) Protein (P30408) (1-202aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-202) |
Form : | Lyophilized powder |
AA Sequence : | MCYGKCARCIGHSLVGLALLCIAANILLYFPNGETKYASENHLSRFVWFFSGIVGGGLLM LLPAFVFIGLEQDDCCGCCGHENCGKRCAMLSSVLAALIGIAGSGYCVIVAALGLAEGPL CLDSLGQWNYTFASTEGQYLLDTSTWSECTEPKHIVEWNVSLFSILLALGGIEFILCLIQ VINGVLGGICGFCCSHQQQYDC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TM4SF1 |
Synonyms | M3S1; Membrane component chromosome 3 surface marker 1; T4S1_HUMAN; TAAL6; Tm4sf1; Transmembrane 4 L6 family member 1; Tumor-associated antigen L6 |
UniProt ID | P30408 |
◆ Recombinant Proteins | ||
TM4SF1-16838M | Recombinant Mouse TM4SF1 Protein | +Inquiry |
TM4SF1-4740R | Recombinant Rhesus monkey TM4SF1 Protein, His-tagged | +Inquiry |
TM4SF1-2942H | Active Recombinant Human TM4SF1 Full Length Transmembrane protein(MNP) | +Inquiry |
TM4SF1-4874C | Recombinant Chicken TM4SF1 | +Inquiry |
TM4SF1-1857H | Recombinant Human TM4SF1 Protein (115-161 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TM4SF1-667HCL | Recombinant Human TM4SF1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TM4SF1 Products
Required fields are marked with *
My Review for All TM4SF1 Products
Required fields are marked with *
0
Inquiry Basket