Recombinant Full Length Human Transmembrane And Ubiquitin-Like Domain-Containing Protein 2(Tmub2) Protein, His-Tagged
Cat.No. : | RFL18188HF |
Product Overview : | Recombinant Full Length Human Transmembrane and ubiquitin-like domain-containing protein 2(TMUB2) Protein (Q71RG4) (1-321aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-321) |
Form : | Lyophilized powder |
AA Sequence : | MISRHLQNNLMSVDPASSQAMELSDVTLIEGVGNEVMVVAGVVVLILALVLAWLSTYVAD SGSNQLLGAIVSAGDTSVLHLGHVDHLVAGQGNPEPTELPHPSEGNDEKAEEAGEGRGDS TGEAGAGGGVEPSLEHLLDIQGLPKRQAGAGSSSPEAPLRSEDSTCLPPSPGLITVRLKF LNDTEELAVARPEDTVGALKSKYFPGQESQMKLIYQGRLLQDPARTLRSLNITDNCVIHC HRSPPGSAVPGPSASLAPSATEPPSLGVNVGSLMVPVFVVLLGVVWYFRINYRQFFTAPA TVSLVGVTVFFSFLVFGMYGR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TMUB2 |
Synonyms | TMUB2; FP2653; UNQ1897/PRO4343; Transmembrane and ubiquitin-like domain-containing protein 2 |
UniProt ID | Q71RG4 |
◆ Recombinant Proteins | ||
Tmub2-6533M | Recombinant Mouse Tmub2 Protein, Myc/DDK-tagged | +Inquiry |
TMUB2-3617H | Recombinant Human TMUB2 protein, GST-tagged | +Inquiry |
TMUB2-1036C | Recombinant Cynomolgus TMUB2 Protein, His-tagged | +Inquiry |
TMUB2-6191R | Recombinant Rat TMUB2 Protein | +Inquiry |
TMUB2-137H | Recombinant Human TMUB2, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMUB2-786HCL | Recombinant Human TMUB2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMUB2 Products
Required fields are marked with *
My Review for All TMUB2 Products
Required fields are marked with *