Recombinant Full Length Rat Transmembrane And Ubiquitin-Like Domain-Containing Protein 2(Tmub2) Protein, His-Tagged
Cat.No. : | RFL20867RF |
Product Overview : | Recombinant Full Length Rat Transmembrane and ubiquitin-like domain-containing protein 2(Tmub2) Protein (Q4FZV7) (1-319aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-319) |
Form : | Lyophilized powder |
AA Sequence : | MISRHLQNNLMSVDPVSSQAMELSDVTLIEGVGNEVMVVAGVVVLTLALVLAWLSTYVAD SSNSQLLGTIVSAGDTSVLHLGHVDQLVNQGTPEPTEHPHPSGGSDDKAEETSDSGGDTT GEPGARGDMEPSLEHLLDIQGLPKRQAGLESSRPEASLGLDDSTCLSPSPSLINVRLKFL NDTEELAVARPEDTVGTLKSKYFPGQESQMKLIYQGRLLQDPARTLSSLNITNNCVIHCH RSPPGAAVSGPSTSLTPTTEQSSLGVNVGSLMVPVFVVLLGVVWYFRINYRQFFTAPATV SLVGVTVFFSFLVFGMYGR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tmub2 |
Synonyms | Tmub2; Transmembrane and ubiquitin-like domain-containing protein 2 |
UniProt ID | Q4FZV7 |
◆ Recombinant Proteins | ||
TMUB2-6191R | Recombinant Rat TMUB2 Protein | +Inquiry |
TMUB2-1417Z | Recombinant Zebrafish TMUB2 | +Inquiry |
TMUB2-1036C | Recombinant Cynomolgus TMUB2 Protein, His-tagged | +Inquiry |
RFL23087MF | Recombinant Full Length Mouse Transmembrane And Ubiquitin-Like Domain-Containing Protein 2(Tmub2) Protein, His-Tagged | +Inquiry |
TMUB2-4671R | Recombinant Rhesus Macaque TMUB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMUB2-786HCL | Recombinant Human TMUB2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tmub2 Products
Required fields are marked with *
My Review for All Tmub2 Products
Required fields are marked with *
0
Inquiry Basket