Recombinant Full Length Human Transmembrane Protein 52(Tmem52) Protein, His-Tagged
Cat.No. : | RFL18104HF |
Product Overview : | Recombinant Full Length Human Transmembrane protein 52(TMEM52) Protein (Q8NDY8) (33-209aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (33-209) |
Form : | Lyophilized powder |
AA Sequence : | FADGSCDPSDQCPPQARWSSLWHVGLILLAVLLLLLCGVTAGCVRFCCLRKQAQAQPHLP PARQPCDVAVIPMDSDSPVHSTVTSYSSVQYPLGMRLPLPFGELDLDSMAPPAYSLYTPE PPPSYDEAVKMAKPREEGPALSQKPSPLLGASGLETTPVPQESGPNTQLPPCSPGAP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TMEM52 |
Synonyms | TMEM52; UNQ3048/PRO9864; Transmembrane protein 52 |
UniProt ID | Q8NDY8 |
◆ Recombinant Proteins | ||
TMEM52-9404M | Recombinant Mouse TMEM52 Protein, His (Fc)-Avi-tagged | +Inquiry |
TMEM52-5928H | Recombinant Human TMEM52 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL6620MF | Recombinant Full Length Mouse Transmembrane Protein 52(Tmem52) Protein, His-Tagged | +Inquiry |
TMEM52-17055M | Recombinant Mouse TMEM52 Protein | +Inquiry |
RFL18104HF | Recombinant Full Length Human Transmembrane Protein 52(Tmem52) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMEM52 Products
Required fields are marked with *
My Review for All TMEM52 Products
Required fields are marked with *