Recombinant Full Length Human Transmembrane Protein 54(Tmem54) Protein, His-Tagged
Cat.No. : | RFL19870HF |
Product Overview : | Recombinant Full Length Human Transmembrane protein 54(TMEM54) Protein (Q969K7) (1-222aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-222) |
Form : | Lyophilized powder |
AA Sequence : | MCLRLGGLSVGDFRKVLMKTGLVLVVLGHVSFITAALFHGTVLRYVGTPQDAVALQYCVV NILSVTSAIVVITSGIAAIVLSRYLPSTPLRWTVFSSSVACALLSLTCALGLLASIAMTF ATQGKALLAACTFGSSELLALAPDCPFDPTRIYSSSLCLWGIALVLCVAENVFAVRCAQL THQLLELRPWWGKSSHHMMRENPELVEGRDLLSCTSSEPLTL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TMEM54 |
Synonyms | TMEM54; BCLP; CAC1; Transmembrane protein 54; Beta-casein-like protein; Protein CAC-1 |
UniProt ID | Q969K7 |
◆ Recombinant Proteins | ||
RFL519MF | Recombinant Full Length Mouse Transmembrane Protein 54(Tmem54) Protein, His-Tagged | +Inquiry |
TMEM54-3293H | Recombinant Human TMEM54, GST-tagged | +Inquiry |
TMEM54-6173R | Recombinant Rat TMEM54 Protein | +Inquiry |
TMEM54-3899Z | Recombinant Zebrafish TMEM54 | +Inquiry |
TMEM54-9407M | Recombinant Mouse TMEM54 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM54-1795HCL | Recombinant Human TMEM54 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMEM54 Products
Required fields are marked with *
My Review for All TMEM54 Products
Required fields are marked with *