Recombinant Full Length Human TRAPPC13 Protein, GST-tagged

Cat.No. : TRAPPC13-2672HF
Product Overview : Human TRAPPC13 full-length ORF (BAB14633.1, 1 a.a. - 354 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 354 amino acids
Description : TRAPPC13 (Trafficking Protein Particle Complex 13) is a Protein Coding gene. Among its related pathways are Vesicle-mediated transport and RAB GEFs exchange GTP for GDP on RABs.
Molecular Mass : 65.9 kDa
AA Sequence : MLTLPQNFGNIFLGETFSSYISVHNDSNQVVKDILVKADLQTSSQRLNLSASNAAVAELKPDCCIDDVIHHEVKEIGTHILVCAVSYTTQAGEKMYFRKFFKFQVLKPLDVKTKFYNAESDLSSVTDEVFLEAQIQNMTTSPMFMEKVSLEPSIMYNVTELNSVSQAGECVSTFGSRAYLQPMDTRQYLYCLKPKNEFAEKAGIIKGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCKITNCSERTMDLVLEMCNTNSIHWCGISGRQLGKLHPSSSLCLALTLLSSVQGLQSISGLRLTDTFLKRTYEYDDIAQVCVVSSAIKVER
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name TRAPPC13 trafficking protein particle complex 13 [ Homo sapiens (human) ]
Official Symbol TRAPPC13
Synonyms TRAPPC13; trafficking protein particle complex 13; C5orf44; Trafficking Protein Particle Complex 13; Trs65-Related; Trafficking Protein Particle Complex Subunit 13; Chromosome 5 Open Reading Frame 44; UPF0533 Protein C5orf44; trafficking protein particle complex subunit 13; Trs65-related; UPF0533 protein C5orf44
Gene ID 80006
mRNA Refseq NM_024941
Protein Refseq NP_079217
UniProt ID A5PLN9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TRAPPC13 Products

Required fields are marked with *

My Review for All TRAPPC13 Products

Required fields are marked with *

0
cart-icon