Recombinant Full Length Human TRIM11 Protein, C-Flag-tagged
Cat.No. : | TRIM11-972HFL |
Product Overview : | Recombinant Full Length Human TRIM11 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to the nucleus and the cytoplasm. Its function has not been identified. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 52.6 kDa |
AA Sequence : | MAAPDLSTNLQEEATCAICLDYFTDPVMTDCGHNFCRECIRRCWGQPEGPYACPECRELSPQRNLRPNRP LAKMAEMARRLHPPSPVPQGVCPAHREPLAAFCGDELRLLCAACERSGEHWAHRVRPLQDAAEDLKAKLE KSLEHLRKQMQDALLFQAQADETCVLWQKMVESQRQNVLGEFERLRRLLAEEEQQLLQRLEEEELEVLPR LREGAAHLGQQSAHLAELIAELEGRCQLPALGLLQDIKDALRRVQDVKLQPPEVVPMELRTVCRVPGLVE TLRRFRGDVTLDPDTANPELILSEDRRSVQRGDLRQALPDSPERFDPGPCVLGQERFTSGRHYWEVEVGD RTSWALGVCRENVNRKEKGELSAGNGFWILVFLGSYYNSSERALAPLRDPPRRVGIFLDYEAGHLSFYSA TDGSLLFIFPEIPFSGTLRPLFSPLSSSPTPMTICRPKGGSGDTLAPQSGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | TRIM11 tripartite motif containing 11 [ Homo sapiens (human) ] |
Official Symbol | TRIM11 |
Synonyms | BIA1; RNF92 |
Gene ID | 81559 |
mRNA Refseq | NM_145214.3 |
Protein Refseq | NP_660215.1 |
MIM | 607868 |
UniProt ID | Q96F44 |
◆ Recombinant Proteins | ||
TRIM11-1107H | Recombinant Human TRIM11 Protein (267-468 aa), His-SUMO-tagged | +Inquiry |
TRIM11-17339M | Recombinant Mouse TRIM11 Protein | +Inquiry |
TRIM11-972HFL | Recombinant Full Length Human TRIM11 Protein, C-Flag-tagged | +Inquiry |
TRIM11-4766R | Recombinant Rhesus Macaque TRIM11 Protein, His (Fc)-Avi-tagged | +Inquiry |
TRIM11-4952R | Recombinant Rhesus monkey TRIM11 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRIM11-796HCL | Recombinant Human TRIM11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRIM11 Products
Required fields are marked with *
My Review for All TRIM11 Products
Required fields are marked with *
0
Inquiry Basket