Recombinant Full Length Human TRIML1 Protein, GST-tagged

Cat.No. : TRIML1-5049HF
Product Overview : Human FLJ36180 full-length ORF ( AAH15684.1, 1 a.a. - 192 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 192 amino acids
Description : The protein encoded by this gene is a tripartite motif family protein with similarities to E3 ubiquitin-protein ligases. While the function of the encoded protein has not been determined, the orthologous protein in mouse has been shown to bind ubiquitin-specific protease 5 and is involved in the blastocyst development stage. [provided by RefSeq, Sep 2016]
Molecular Mass : 47.8 kDa
AA Sequence : MKEMLRKFSTEITLDPATANAYLVLSEDLKSVKYGGSRQQLPDNPERFDQSATVLGTQIFTSGRHYWEVEVGNKTEWEVGICKDSVSRKGNLPKPPGDLFSLIGLKIGDDYSLWVSSPLKGQHVREPVCKVGVFLDYESGHIAFYNGTDESLIYSFPQASFQEALRPIFSPCLPNEGTNTDPLTICSLNSHV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name TRIML1 tripartite motif family-like 1 [ Homo sapiens ]
Official Symbol TRIML1
Synonyms TRIML1; tripartite motif family-like 1; probable E3 ubiquitin-protein ligase TRIML1; FLJ36180; RNF209; RING finger protein 209; tripartite motif family-like protein 1; MGC138638; MGC138639;
Gene ID 339976
mRNA Refseq NM_178556
Protein Refseq NP_848651
UniProt ID Q8N9V2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TRIML1 Products

Required fields are marked with *

My Review for All TRIML1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon