Recombinant Full Length Human TRIML1 Protein, GST-tagged
Cat.No. : | TRIML1-5049HF |
Product Overview : | Human FLJ36180 full-length ORF ( AAH15684.1, 1 a.a. - 192 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 192 amino acids |
Description : | The protein encoded by this gene is a tripartite motif family protein with similarities to E3 ubiquitin-protein ligases. While the function of the encoded protein has not been determined, the orthologous protein in mouse has been shown to bind ubiquitin-specific protease 5 and is involved in the blastocyst development stage. [provided by RefSeq, Sep 2016] |
Molecular Mass : | 47.8 kDa |
AA Sequence : | MKEMLRKFSTEITLDPATANAYLVLSEDLKSVKYGGSRQQLPDNPERFDQSATVLGTQIFTSGRHYWEVEVGNKTEWEVGICKDSVSRKGNLPKPPGDLFSLIGLKIGDDYSLWVSSPLKGQHVREPVCKVGVFLDYESGHIAFYNGTDESLIYSFPQASFQEALRPIFSPCLPNEGTNTDPLTICSLNSHV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | TRIML1 tripartite motif family-like 1 [ Homo sapiens ] |
Official Symbol | TRIML1 |
Synonyms | TRIML1; tripartite motif family-like 1; probable E3 ubiquitin-protein ligase TRIML1; FLJ36180; RNF209; RING finger protein 209; tripartite motif family-like protein 1; MGC138638; MGC138639; |
Gene ID | 339976 |
mRNA Refseq | NM_178556 |
Protein Refseq | NP_848651 |
UniProt ID | Q8N9V2 |
◆ Recombinant Proteins | ||
TRIML1-5049HF | Recombinant Full Length Human TRIML1 Protein, GST-tagged | +Inquiry |
TRIML1-1454H | Recombinant Human TRIML1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Triml1-6665M | Recombinant Mouse Triml1 Protein, Myc/DDK-tagged | +Inquiry |
TRIML1-17402M | Recombinant Mouse TRIML1 Protein | +Inquiry |
TRIML1-9627M | Recombinant Mouse TRIML1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRIML1-760HCL | Recombinant Human TRIML1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRIML1 Products
Required fields are marked with *
My Review for All TRIML1 Products
Required fields are marked with *