Recombinant Full Length Human TRMT112 Protein, C-Flag-tagged

• Cat.No.: TRMT112-1958HFL
• Product Overview: Recombinant Full Length Human TRMT112 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: Enables protein heterodimerization activity and protein methyltransferase activity. Involved in macromolecule methylation and positive regulation of rRNA processing. Located in nucleoplasm and perinuclear region of cytoplasm. Part of protein-containing complex.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 14 kDa
• AA Sequence: MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVEWSAFLEAADNLRLIQVPKGP VEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSEEETES myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Full Length: Full L.

Gene Information

• Gene Name: TRMT112 tRNA methyltransferase activator subunit 11-2 [ Homo sapiens (human) ]
• Official Symbol: TRMT112
• Synonyms: TRM112; HSPC152; HSPC170; hTrm112; TRMT11-2
• Gene ID: 51504
• mRNA Refseq: NM_016404.3
• Protein Refseq: NP_057488
• MIM: 618630
• UniProt ID: Q9UI30