Recombinant Full Length Human TRMT112 Protein, C-Flag-tagged

Cat.No. : TRMT112-1958HFL
Product Overview : Recombinant Full Length Human TRMT112 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : Enables protein heterodimerization activity and protein methyltransferase activity. Involved in macromolecule methylation and positive regulation of rRNA processing. Located in nucleoplasm and perinuclear region of cytoplasm. Part of protein-containing complex.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 14 kDa
AA Sequence : MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVEWSAFLEAADNLRLIQVPKGP VEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSEEETES myc-FLAG tag
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Full Length : Full L.
Gene Name TRMT112 tRNA methyltransferase activator subunit 11-2 [ Homo sapiens (human) ]
Official Symbol TRMT112
Synonyms TRM112; HSPC152; HSPC170; hTrm112; TRMT11-2
Gene ID 51504
mRNA Refseq NM_016404.3
Protein Refseq NP_057488
MIM 618630
UniProt ID Q9UI30

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TRMT112 Products

Required fields are marked with *

My Review for All TRMT112 Products

Required fields are marked with *

0
cart-icon
0
compare icon