Recombinant Full Length Human TRMT112 Protein, C-Flag-tagged
Cat.No. : | TRMT112-1958HFL |
Product Overview : | Recombinant Full Length Human TRMT112 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables protein heterodimerization activity and protein methyltransferase activity. Involved in macromolecule methylation and positive regulation of rRNA processing. Located in nucleoplasm and perinuclear region of cytoplasm. Part of protein-containing complex. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 14 kDa |
AA Sequence : | MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVEWSAFLEAADNLRLIQVPKGP VEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSEEETES myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | TRMT112 tRNA methyltransferase activator subunit 11-2 [ Homo sapiens (human) ] |
Official Symbol | TRMT112 |
Synonyms | TRM112; HSPC152; HSPC170; hTrm112; TRMT11-2 |
Gene ID | 51504 |
mRNA Refseq | NM_016404.3 |
Protein Refseq | NP_057488 |
MIM | 618630 |
UniProt ID | Q9UI30 |
◆ Recombinant Proteins | ||
TRMT112-1958HFL | Recombinant Full Length Human TRMT112 Protein, C-Flag-tagged | +Inquiry |
TRMT112-5269H | Recombinant Human TRMT112 Protein, GST-tagged | +Inquiry |
TRMT112-5148H | Recombinant Human TRMT112 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TRMT112-5654HF | Recombinant Full Length Human TRMT112 Protein, GST-tagged | +Inquiry |
TRMT112-1645H | Recombinant Human TRMT112 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRMT112-756HCL | Recombinant Human TRMT112 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TRMT112 Products
Required fields are marked with *
My Review for All TRMT112 Products
Required fields are marked with *
0
Inquiry Basket