"TRMT112" Related Products

Expand
Expand

Recombinant Human TRMT112 Protein (1-125 aa), His-SUMO-tagged

Cat.No. : TRMT112-1148H
Product Overview : Recombinant Human TRMT112 Protein (1-125 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Metabolism. Protein Description: Full Length.
Description : Participates both in methylation of protein and tRNA species. The heterodimer with HK2/N6AMT1 catalyzes N5-methylation of ETF1 on 'Gln-185', using S-adenosyl L-methionine as methyl donor. The heterodimer with ALKBH8 catalyzes the methylation of 5-carboxymethyl uridine to 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in target tRNA species.
Source : E. coli
Species : Human
Tag : His-SUMO
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 30.2 kDa
Protein length : 1-125 aa
AA Sequence : MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVEWSAFLEAADNLRLIQVPKGPVEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSEEETES
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Figure :

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Gene Name : TRMT112 tRNA methyltransferase 11-2 homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol : TRMT112
Synonyms : TRMT112; HSPC152; HSPC170; TRM112; TRMT11 2; TRMT11-2;
Gene ID : 51504
mRNA Refseq : NM_016404
Protein Refseq : NP_057488
UniProt ID : Q9UI30

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.