Recombinant Human TRMT112 Protein (1-125 aa), His-SUMO-tagged
| Cat.No. : | TRMT112-1148H |
| Product Overview : | Recombinant Human TRMT112 Protein (1-125 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Metabolism. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-125 aa |
| Description : | Participates both in methylation of protein and tRNA species. The heterodimer with HK2/N6AMT1 catalyzes N5-methylation of ETF1 on 'Gln-185', using S-adenosyl L-methionine as methyl donor. The heterodimer with ALKBH8 catalyzes the methylation of 5-carboxymethyl uridine to 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in target tRNA species. |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 30.2 kDa |
| AA Sequence : | MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVEWSAFLEAADNLRLIQVPKGPVEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSEEETES |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | TRMT112 tRNA methyltransferase 11-2 homolog (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | TRMT112 |
| Synonyms | TRMT112; HSPC152; HSPC170; TRM112; TRMT11 2; TRMT11-2; |
| Gene ID | 51504 |
| mRNA Refseq | NM_016404 |
| Protein Refseq | NP_057488 |
| UniProt ID | Q9UI30 |
| ◆ Recombinant Proteins | ||
| TRMT112-5148H | Recombinant Human TRMT112 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| TRMT112-2261H | Recombinant Human TRMT112 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TRMT112-5654HF | Recombinant Full Length Human TRMT112 Protein, GST-tagged | +Inquiry |
| TRMT112-4980R | Recombinant Rhesus monkey TRMT112 Protein, His-tagged | +Inquiry |
| TRMT112-2892Z | Recombinant Zebrafish TRMT112 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TRMT112-756HCL | Recombinant Human TRMT112 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRMT112 Products
Required fields are marked with *
My Review for All TRMT112 Products
Required fields are marked with *
