Recombinant Human TRMT112 Protein (1-125 aa), His-SUMO-tagged

Cat.No. : TRMT112-1148H
Product Overview : Recombinant Human TRMT112 Protein (1-125 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Metabolism. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 1-125 aa
Description : Participates both in methylation of protein and tRNA species. The heterodimer with HK2/N6AMT1 catalyzes N5-methylation of ETF1 on 'Gln-185', using S-adenosyl L-methionine as methyl donor. The heterodimer with ALKBH8 catalyzes the methylation of 5-carboxymethyl uridine to 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in target tRNA species.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 30.2 kDa
AA Sequence : MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVEWSAFLEAADNLRLIQVPKGPVEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSEEETES
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name TRMT112 tRNA methyltransferase 11-2 homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol TRMT112
Synonyms TRMT112; HSPC152; HSPC170; TRM112; TRMT11 2; TRMT11-2;
Gene ID 51504
mRNA Refseq NM_016404
Protein Refseq NP_057488
UniProt ID Q9UI30

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TRMT112 Products

Required fields are marked with *

My Review for All TRMT112 Products

Required fields are marked with *

0
cart-icon
0
compare icon