Recombinant Full Length Human TSG101 protein, GST-tagged
Cat.No. : | TSG101-32H |
Product Overview : | Recombinant Human TSG101(1 a.a. - 390 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-390 a.a. |
Description : | The protein encoded by this gene belongs to a group of apparently inactive homologs of ubiquitin-conjugating enzymes. The gene product contains a coiled-coil domain that interacts with stathmin, a cytosolic phosphoprotein implicated in tumorigenesis. The protein may play a role in cell growth and differentiation and act as a negative growth regulator. In vitro steady-state ex |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 70.3 kDa |
AA Sequence : | MAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNIPICLW LLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRPISASY PPYQATGPPNTSYMPGMPGGISPYPSGYPPNPSGYPGCPYPPGGPYPATTSSQYPSQPPVTTVGPSRDGTISEDT IRASLISAVSDKLRWRMKEEMDRAQAELNALKRTEEDLKKGHQKLEEMVTRLDQEVAEVDKNIELLKKKDEELSS ALEKMENQSENNDIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRA LMQKARKTAGLSDLY |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | TSG101 tumor susceptibility gene 101 [ Homo sapiens ] |
Official Symbol | TSG101 |
Synonyms | TSG101; tumor susceptibility gene 101; TSG10, tumor susceptibility gene 10; tumor susceptibility gene 101 protein; VPS23; tumor susceptibility protein; ESCRT-I complex subunit TSG101; TSG10; |
Gene ID | 7251 |
mRNA Refseq | NM_006292 |
Protein Refseq | NP_006283 |
MIM | 601387 |
UniProt ID | Q99816 |
Chromosome Location | 11p15 |
Pathway | Assembly of HIV virion, organism-specific biosystem; Disease, organism-specific biosystem; ESCRT-I complex, organism-specific biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; Endosomal Sorting Complex Required For Transport (ESCRT), organism-specific biosystem; Glucocorticoid receptor regulatory network, organism-specific biosystem; |
Function | DNA binding; calcium-dependent protein binding; ligand-dependent nuclear receptor transcription coactivator activity; protein binding; transcription corepressor activity; ubiquitin binding; ubiquitin protein ligase binding; |
◆ Recombinant Proteins | ||
TSG101-6314R | Recombinant Rat TSG101 Protein | +Inquiry |
TSG101-30749TH | Recombinant Human TSG101, His-tagged | +Inquiry |
TSG101-495H | Recombinant Human TSG101 Protein, His-tagged | +Inquiry |
TSG101-32H | Recombinant Full Length Human TSG101 protein, GST-tagged | +Inquiry |
TSG101-2357H | Recombinant Human Tumor Susceptibility Gene 101, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TSG101-719HCL | Recombinant Human TSG101 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TSG101 Products
Required fields are marked with *
My Review for All TSG101 Products
Required fields are marked with *
0
Inquiry Basket