Recombinant Full Length Human TSG101 protein, GST-tagged

Cat.No. : TSG101-32H
Product Overview : Recombinant Human TSG101(1 a.a. - 390 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Availability May 21, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-390 a.a.
Description : The protein encoded by this gene belongs to a group of apparently inactive homologs of ubiquitin-conjugating enzymes. The gene product contains a coiled-coil domain that interacts with stathmin, a cytosolic phosphoprotein implicated in tumorigenesis. The protein may play a role in cell growth and differentiation and act as a negative growth regulator. In vitro steady-state expression of this tumor susceptibility gene appears to be important for maintenance of genomic stability and cell cycle regulation. Mutations and alternative splicing in this gene occur in high frequency in breast cancer and suggest that defects occur during breast cancer tumorigenesis and/or progression.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 70.3 kDa
AA Sequence : MAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNIPICLW LLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRPISASY PPYQATGPPNTSYMPGMPGGISPYPSGYPPNPSGYPGCPYPPGGPYPATTSSQYPSQPPVTTVGPSRDGTISEDT IRASLISAVSDKLRWRMKEEMDRAQAELNALKRTEEDLKKGHQKLEEMVTRLDQEVAEVDKNIELLKKKDEELSS ALEKMENQSENNDIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRA LMQKARKTAGLSDLY
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name TSG101 tumor susceptibility gene 101 [ Homo sapiens ]
Official Symbol TSG101
Synonyms TSG101; tumor susceptibility gene 101; TSG10, tumor susceptibility gene 10; tumor susceptibility gene 101 protein; VPS23; tumor susceptibility protein; ESCRT-I complex subunit TSG101; TSG10;
Gene ID 7251
mRNA Refseq NM_006292
Protein Refseq NP_006283
MIM 601387
UniProt ID Q99816
Chromosome Location 11p15
Pathway Assembly of HIV virion, organism-specific biosystem; Disease, organism-specific biosystem; ESCRT-I complex, organism-specific biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; Endosomal Sorting Complex Required For Transport (ESCRT), organism-specific biosystem; Glucocorticoid receptor regulatory network, organism-specific biosystem;
Function DNA binding; calcium-dependent protein binding; ligand-dependent nuclear receptor transcription coactivator activity; protein binding; transcription corepressor activity; ubiquitin binding; ubiquitin protein ligase binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TSG101 Products

Required fields are marked with *

My Review for All TSG101 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon