Recombinant Full Length Human TUBA3FP Protein, GST-tagged

Cat.No. : TUBA3FP-6151HF
Product Overview : Human MGC16703 full-length ORF ( NP_659479.2, 1 a.a. - 154 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 154 amino acids
Description : TUBA3FP (Tubulin Alpha 3f Pseudogene) is a Pseudogene.
Molecular Mass : 43.1 kDa
AA Sequence : MQLSGNGLEEQAAQHLDELLLAHTDLKSLDLSYNQLNDQADLCMGLQGFLIFHSFGGGTGSGFVSLLMKRLSVDYGKKSKLEFAICPAPQVSMAMTEPYNSILTTYTTLEHSDCAFIVNSKATYDMSAQPGHRVSHVHQPQSSGQIVSSITASL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name TUBA3FP tubulin alpha 3f pseudogene [ Homo sapiens (human) ]
Official Symbol TUBA3FP
Synonyms TUBA3FP; tubulin alpha 3f pseudogene; tubulin, alpha pseudogene
Gene ID 113691

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TUBA3FP Products

Required fields are marked with *

My Review for All TUBA3FP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon