Recombinant Full Length Human Tumor-Associated Calcium Signal Transducer 2(Tacstd2) Protein, His-Tagged
Cat.No. : | RFL18820HF |
Product Overview : | Recombinant Full Length Human Tumor-associated calcium signal transducer 2(TACSTD2) Protein (P09758) (27-323aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (27-323) |
Form : | Lyophilized powder |
AA Sequence : | HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TACSTD2 |
Synonyms | TACSTD2; GA733-1; M1S1; TROP2; Tumor-associated calcium signal transducer 2; Cell surface glycoprotein Trop-2; Membrane component chromosome 1 surface marker 1; Pancreatic carcinoma marker protein GA733-1 |
UniProt ID | P09758 |
◆ Recombinant Proteins | ||
TACSTD2-5864H | Recombinant Human TACSTD2 Protein (Met1-Thr274), C-His tagged | +Inquiry |
TACSTD2-30080TH | Recombinant Human TACSTD2 | +Inquiry |
TACSTD2-30839TH | Recombinant Human TACSTD2 | +Inquiry |
TACSTD2-0767H | Active Recombinant Human TACSTD2 protein, His-Avi-tagged, Biotinylated | +Inquiry |
TACSTD2-0232H | Recombinant Human TACSTD2 protein, His-tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
TACSTD2-2546HCL | Recombinant Human TACSTD2 cell lysate | +Inquiry |
TACSTD2-1630MCL | Recombinant Mouse TACSTD2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TACSTD2 Products
Required fields are marked with *
My Review for All TACSTD2 Products
Required fields are marked with *
0
Inquiry Basket