Recombinant Human TACSTD2 protein, His-tagged

Cat.No. : TACSTD2-5633H
Product Overview : Recombinant Human TACSTD2 protein(P09758)(27-274aa), fused with C-terminal His tag, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 27-274aa
Tag : C-His
Form : Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Bio-activity : Measured by its binding ability in a functional ELISA. Immobilized Human TROP2 at 2 μg/mL can bind Anti-TROP2 recombinant antibody, the EC50 is 0.7284-1.075 ng/mL.
Molecular Mass : 30.6 kDa
Endotoxin : Less than 1.0 EU/ug as determined by LAL method.
Purity : Greater than 95% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT
Gene Name TACSTD2 tumor-associated calcium signal transducer 2 [ Homo sapiens ]
Official Symbol TACSTD2
Synonyms TACSTD2; tumor-associated calcium signal transducer 2; M1S1; EGP 1; GA733 1; TROP2; epithelial glycoprotein-1; cell surface glycoprotein TROP2; cell surface glycoprotein Trop-2; pancreatic carcinoma marker protein GA7331; pancreatic carcinoma marker protein GA733-1; gastrointestinal tumor-associated antigen GA7331; membrane component chromosome 1 surface marker 1; membrane component, chromosome 1, surface marker 1; 40kD glycoprotein, identified by monoclonal GA733; EGP1; GP50; EGP-1; GA7331; GA733-1;
Gene ID 4070
mRNA Refseq NM_002353
Protein Refseq NP_002344
MIM 137290
UniProt ID P09758

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TACSTD2 Products

Required fields are marked with *

My Review for All TACSTD2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon