Recombinant Human TACSTD2 protein, His-tagged
| Cat.No. : | TACSTD2-5633H |
| Product Overview : | Recombinant Human TACSTD2 protein(P09758)(27-274aa), fused with C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 27-274aa |
| Tag : | C-His |
| Form : | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Bio-activity : | Measured by its binding ability in a functional ELISA. Immobilized Human TROP2 at 2 μg/mL can bind Anti-TROP2 recombinant antibody, the EC50 is 0.7284-1.075 ng/mL. |
| Molecular Mass : | 30.6 kDa |
| Endotoxin : | Less than 1.0 EU/ug as determined by LAL method. |
| Purity : | Greater than 95% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT |
| Gene Name | TACSTD2 tumor-associated calcium signal transducer 2 [ Homo sapiens ] |
| Official Symbol | TACSTD2 |
| Synonyms | TACSTD2; tumor-associated calcium signal transducer 2; M1S1; EGP 1; GA733 1; TROP2; epithelial glycoprotein-1; cell surface glycoprotein TROP2; cell surface glycoprotein Trop-2; pancreatic carcinoma marker protein GA7331; pancreatic carcinoma marker protein GA733-1; gastrointestinal tumor-associated antigen GA7331; membrane component chromosome 1 surface marker 1; membrane component, chromosome 1, surface marker 1; 40kD glycoprotein, identified by monoclonal GA733; EGP1; GP50; EGP-1; GA7331; GA733-1; |
| Gene ID | 4070 |
| mRNA Refseq | NM_002353 |
| Protein Refseq | NP_002344 |
| MIM | 137290 |
| UniProt ID | P09758 |
| ◆ Recombinant Proteins | ||
| TACSTD2-5568R | Recombinant Rat TACSTD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TACSTD2-930M | Active Recombinant Mouse TACSTD2 Protein, His-tagged | +Inquiry |
| TACSTD2-30080TH | Recombinant Human TACSTD2 | +Inquiry |
| TACSTD2-30839TH | Recombinant Human TACSTD2 | +Inquiry |
| TACSTD2-5909R | Recombinant Rat TACSTD2 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TACSTD2-2546HCL | Recombinant Human TACSTD2 cell lysate | +Inquiry |
| TACSTD2-1630MCL | Recombinant Mouse TACSTD2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TACSTD2 Products
Required fields are marked with *
My Review for All TACSTD2 Products
Required fields are marked with *



