Recombinant Full Length Human Tumor Necrosis Factor Receptor Superfamily Member 3(Ltbr) Protein, His-Tagged
| Cat.No. : | RFL35243HF |
| Product Overview : | Recombinant Full Length Human Tumor necrosis factor receptor superfamily member 3(LTBR) Protein (P36941) (31-435aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (31-435) |
| Form : | Lyophilized powder |
| AA Sequence : | QAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLMLAVLLPLAFFLLLATVFSCIWKSHPSLCRKLGSLLKRRPQGEGPNPVAGSWEPPKAHPYFPDLVQPLLPISGDVSPVSTGLPAAPVLEAGVPQQQSPLDLTREPQLEPGEQSQVAHGTNGIHVTGGSMTITGNIYIYNGPVLGGPPGPGDLPATPEPPYPIPEEGDPGPPGLSTPHQEDGKAWHLAETEHCGATPSNRGPRNQFITHD |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | LTBR |
| Synonyms | CD18; D12S370; LT beta R; LTBETAR; Ltbr; Lymphotoxin B receptor; Lymphotoxin beta receptor (TNFR superfamily; member 3); Lymphotoxin beta receptor; Lymphotoxin-beta receptor; TNF R III; TNF-RIII; TNFCR; TNFR RP; TNFR superfamily member 3; TNFR-III; TNFR2 |
| UniProt ID | P36941 |
| ◆ Recombinant Proteins | ||
| LTBR-399H | Recombinant Human LTBR protein, Fc-tagged | +Inquiry |
| LTBR-4467H | Recombinant Human LTBR Protein (Gln31-Met227), N-His tagged | +Inquiry |
| LTBR-745H | Active Recombinant Human LTBR, Fc Chimera | +Inquiry |
| LTBR-635H | Active Recombinant Human LTBR protein, Fc-tagged | +Inquiry |
| LTBR-746H | Active Recombinant Human LTBR, Fc Chimera | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LTBR-1229CCL | Recombinant Cynomolgus LTBR cell lysate | +Inquiry |
| LTBR-1052RCL | Recombinant Rat LTBR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LTBR Products
Required fields are marked with *
My Review for All LTBR Products
Required fields are marked with *
