Recombinant Full Length Human TUT7 Protein, GST-tagged
| Cat.No. : | TUT7-6862HF |
| Product Overview : | Human ZCCHC6 full-length ORF ( AAH32456.1, 1 a.a. - 412 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 412 amino acids |
| Description : | Uridylyltransferase that mediates the terminal uridylation of mRNAs with short (less than 25 nucleotides) poly(A) tails, hence facilitating global mRNA decay. Essential for both oocyte maturation and fertility. Through 3' terminal uridylation of mRNA, sculpts, with TUT7, the maternal transcriptome by eliminating transcripts during oocyte growth. Involved in microRNA (miRNA)-induced gene silencing through uridylation of deadenylated miRNA targets. Also functions as an integral regulator of microRNA biogenesiS using 3 different uridylation mechanisms. Acts as a suppressor of miRNA biogenesis by mediating the terminal uridylation of some miRNA precursors, including that of let-7 (pre-let-7). Uridylated pre-let-7 RNA is not processed by Dicer and undergo degradation. Pre-let-7 uridylation is strongly enhanced in the presence of LIN28A. In the absence of LIN28A, TUT7 and TUT4 monouridylate group II pre-miRNAs, which includes most of pre-let7 members, that shapes an optimal 3' end overhang for efficient processing. Add oligo-U tails to truncated pre-miRNAS with a 5' overhang which may promote rapid degradation of non-functional pre-miRNA species. Does not play a role in replication-dependent histone mRNA degradation. Due to functional redundancy between TUT4 and TUT7, the identification of the specific role of each of these proteins is difficult. TUT4 and TUT7 restrict retrotransposition of long interspersed element-1 (LINE-1) in cooperation with MOV10 counteracting the RNA chaperonne activity of L1RE1. TUT7 uridylates LINE-1 mRNAs in the cytoplasm which inhibits initiation of reverse transcription once in the nucleus, whereas uridylation by TUT4 destabilizes mRNAs in cytoplasmic ribonucleoprotein granules. |
| Molecular Mass : | 74.3 kDa |
| AA Sequence : | MGDTAKPYFVKRTKDRGTMDDDDFRRGHPQQDYLIIDDHAKGHGSKMEKGLQKKKITPGNYGNTPRKGPCAVSSNPYAFKNPIYSQPAWMNDSHKDQSKRWLSDEHTGNSDNWREFKPGPRIPVINRQRKDSFQENEDGYRWQDTRGCRTVRRLFHKDLTSLETTSEMEAGSPENKKQRSRPRKPRKTRNEENEQDGDLEGPVIDESVLSTKELLGLQQAEERLKRDCIDRLKRRPRNYPTAKYTCRLCDVLIESIAFAHKHIKEKRHKKNIKEKQEEELLTTLPPPTPSQINAVGIAIDKVVQEFGLHNENLEQRLEIKRIMENVFQHKLPDCSLRLYGSSCSRLGFKNSDVNIDIQFPAIMSQPDVLLLVQECLKNSDSFIDVDADFHARVPVVVCREKQRSHFFKLFIY |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | TUT7 terminal uridylyl transferase 7 [ Homo sapiens (human) ] |
| Official Symbol | TUT7 |
| Synonyms | TUT7; terminal uridylyl transferase 7; PAPD6; TENT3B; ZCCHC6; terminal uridylyltransferase 7; PAP associated domain containing 6; TUTase 7; zinc finger CCHC domain-containing protein 6; zinc finger CCHC-type containing 6; zinc finger, CCHC domain containing 6; EC 2.7.7.52 |
| Gene ID | 79670 |
| mRNA Refseq | NM_024617 |
| Protein Refseq | NP_078893 |
| MIM | 613467 |
| UniProt ID | Q5VYS8 |
| ◆ Recombinant Proteins | ||
| TUT7-2641H | Recombinant Human TUT7 Protein, GST-tagged | +Inquiry |
| TUT7-6862HF | Recombinant Full Length Human TUT7 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TUT7 Products
Required fields are marked with *
My Review for All TUT7 Products
Required fields are marked with *
