Recombinant Full Length Human TWIST1 Protein, C-Flag-tagged
Cat.No. : | TWIST1-2100HFL |
Product Overview : | Recombinant Full Length Human TWIST1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a basic helix-loop-helix (bHLH) transcription factor that plays an important role in embryonic development. The encoded protein forms both homodimers and heterodimers that bind to DNA E box sequences and regulate the transcription of genes involved in cranial suture closure during skull development. This protein may also regulate neural tube closure, limb development and brown fat metabolism. This gene is hypermethylated and overexpressed in multiple human cancers, and the encoded protein promotes tumor cell invasion and metastasis, as well as metastatic recurrence. Mutations in this gene cause Saethre-Chotzen syndrome in human patients, which is characterized by craniosynostosis, ptosis and hypertelorism. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 20.8 kDa |
AA Sequence : | MMQDVSSSPVSPADDSLSNSEEEPDRQQPPSGKRGGRKRRSSRRSAGGGAGPGGAAGGGVGGGDEPGSP AQGKRGKKSAGCGGGGGAGGGGGSSSGGGSPQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTL PSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSASH SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | TWIST1 twist family bHLH transcription factor 1 [ Homo sapiens (human) ] |
Official Symbol | TWIST1 |
Synonyms | CRS; CSO; SCS; ACS3; CRS1; BPES2; BPES3; SWCOS; TWIST; bHLHa38 |
Gene ID | 7291 |
mRNA Refseq | NM_000474.4 |
Protein Refseq | NP_000465.1 |
MIM | 601622 |
UniProt ID | Q15672 |
◆ Recombinant Proteins | ||
TWIST1-2622H | Recombinant Human TWIST1 protein, GST-tagged | +Inquiry |
TWIST1-2621H | Recombinant Human TWIST1 protein, His-tagged | +Inquiry |
TWIST1-2973H | Recombinant Human TWIST1 Protein, MYC/DDK-tagged | +Inquiry |
TWIST1-6304C | Recombinant Chicken TWIST1 | +Inquiry |
TWIST1-6522H | Recombinant Human TWIST1 Protein (Met1-His202), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TWIST1-1865HCL | Recombinant Human TWIST1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TWIST1 Products
Required fields are marked with *
My Review for All TWIST1 Products
Required fields are marked with *
0
Inquiry Basket