Recombinant Full Length Human TXN Protein, C-Flag-tagged

Cat.No. : TXN-793HFL
Product Overview : Recombinant Full Length Human TXN Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : The protein encoded by this gene acts as a homodimer and is involved in many redox reactions. The encoded protein is active in the reversible S-nitrosylation of cysteines in certain proteins, which is part of the response to intracellular nitric oxide. This protein is found in the cytoplasm. Two transcript variants encoding different isoforms have been found for this gene.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 11.6 kDa
AA Sequence : MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECE
VKCMPTFQFFKKGQKVGEFSGANKEKLEATINELVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Druggable Genome
Full Length : Full L.
Gene Name TXN thioredoxin [ Homo sapiens (human) ]
Official Symbol TXN
Synonyms TRX; TRDX; TRX1; Trx80
Gene ID 7295
mRNA Refseq NM_003329.4
Protein Refseq NP_003320.2
MIM 187700
UniProt ID P10599

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TXN Products

Required fields are marked with *

My Review for All TXN Products

Required fields are marked with *

0

Inquiry Basket

cartIcon