Recombinant Full Length Human UAP1 Protein, C-Flag-tagged
Cat.No. : | UAP1-1407HFL |
Product Overview : | Recombinant Full Length Human UAP1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables identical protein binding activity. Predicted to be involved in UDP-N-acetylglucosamine biosynthetic process. Located in cytosol; nucleoplasm; and plasma membrane. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 56.8 kDa |
AA Sequence : | MNINDLKLTLSKAGQEHLLRFWNELEEAQQVELYAELQAMNFEELNFFFQKAIEGFNQSSYQKNVDARME PVPREVLGSATRDQDQLQAWESEGLFQISQNKVAVLLLAGGQGTRLGVAYPKGMYDVGLPSRKTLFQIQA ERILKLQQVAEKYYGNKCIIPWYIMTSGRTMESTKEFFTKHKYFGLKKENVIFFQQGMLPAMSFDGKIIL EEKNKVSMAPDGNGGLYRALAAQNIVEDMEQRGIWSIHVYCVDNILVKVADPRFIGFCIQKGADCGAKVV EKTNPTEPVGVVCRVDGVYQVVEYSEISLATAQKRSSDGRLLFNAGNIANHFFTVPFLRDVVNVYEPQLQ HHVAQKKIPYVDTQGQLIKPDKPNGIKMEKFVFDIFQFAKKFVVYEVLREDEFSPLKNADSQNGKDNPTT ARHALMSLHHCWVLNAGGHFIDENGSRLPAIPRLKDANDVPIQCEISPLISYAGEGLESYVADKEFHAPL IIDENGVHELVKNGITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Amino sugar and nucleotide sugar metabolism, Metabolic pathways |
Full Length : | Full L. |
Gene Name | UAP1 UDP-N-acetylglucosamine pyrophosphorylase 1 [ Homo sapiens (human) ] |
Official Symbol | UAP1 |
Synonyms | AGX; AGX1; AGX2; SPAG2 |
Gene ID | 6675 |
mRNA Refseq | NM_003115.6 |
Protein Refseq | NP_003106.3 |
MIM | 602862 |
UniProt ID | A0A140VKC0 |
◆ Recombinant Proteins | ||
UAP1-2162H | Recombinant Human UAP1 Protein (1-522 aa), His-tagged | +Inquiry |
UAP1-2289H | Recombinant Human UAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
UAP1-1393H | Recombinant Human UAP1 Protein, His-tagged | +Inquiry |
UAP1-1407HFL | Recombinant Full Length Human UAP1 Protein, C-Flag-tagged | +Inquiry |
UAP1-0329H | Recombinant Human UAP1 Protein (M1-I522), His/Strep tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UAP1-607HCL | Recombinant Human UAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UAP1 Products
Required fields are marked with *
My Review for All UAP1 Products
Required fields are marked with *
0
Inquiry Basket