Recombinant Full Length Human UBA6 Protein, GST-tagged

Cat.No. : UBA6-4848HF
Product Overview : Human FLJ10808 full-length ORF ( AAH31637, 1 a.a. - 389 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 389 amino acids
Description : Modification of proteins with ubiquitin (UBB; MIM 191339) or ubiquitin-like proteins controls many signaling networks and requires a ubiquitin-activating enzyme (E1), a ubiquitin conjugating enzyme (E2), and a ubiquitin protein ligase (E3). UBE1L2 is an E1 enzyme that initiates the activation and conjugation of ubiquitin-like proteins (Jin et al., 2007 [PubMed 17597759]).[supplied by OMIM
Molecular Mass : 68.31 kDa
AA Sequence : MEGSEPVAAHQGEEASCSSWGTGSTNKNLPIMSTASVEIDDALYSRQRYVLGDTAMQKMAKSHVFLSGMGGLGLEIAKNLVLAGIKAVTIHDTEKCQAWDLGTNFFLSEDDVVNKRNRAEAVLKHIAELNPYVHVTSSSVPFNETTDLSFLDKYQCVVLTEMKLPLQKKINDFCRSQCPPIKFISADVHGIWSRLFCDFGDEFEVLDTTGEEPKEIFISNITQANPGIVTCLENHPHKLETGQFLTFREINGMTGLNGSIQQITVISPFSFSIGDTTELEPYLHGGIAVQVKTPKTVFFESLERQLKHPKCLIVDFSNPEAPLEIHTAMLALDQFQEKYSRKPNVGCQQDSEELLKLATSISETLEEKVTIEIYGCPNICLLIHKCSVY
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name UBA6 ubiquitin-like modifier activating enzyme 6 [ Homo sapiens ]
Official Symbol UBA6
Synonyms UBA6; ubiquitin-like modifier activating enzyme 6; UBE1L2, ubiquitin activating enzyme E1 like 2; ubiquitin-like modifier-activating enzyme 6; FLJ10808; ubiquitin activating enzyme E1; monocyte protein 4; ubiquitin-activating enzyme 6; UBA6, ubiquitin-activating enzyme E1; ubiquitin-activating enzyme E1-like 2; ubiquitin-activating enzyme E1-like protein 2; E1-L2; MOP-4; UBE1L2; FLJ23367;
Gene ID 55236
mRNA Refseq NM_018227
Protein Refseq NP_060697
MIM 611361
UniProt ID A0AVT1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UBA6 Products

Required fields are marked with *

My Review for All UBA6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon